CTHRC1 (Collagen triple helix repeat-containing protein 1) is a 28-30 kDa, secreted glycoprotein that bears similarity to the C1q/TNFalpha-related family of proteins. It is expressed by disparate cell types, including renal epithelium, neurons, osteoblasts, and smooth muscle cells. Functionally, it is recognized to be induced by BMP-2 and to block TGF beta-induced collagen type I and III synthesis. Mouse CTHRC1 is 245 amino acids in length. It contains a 32 amino acid (aa) signal sequence, a 16 aa prosegment (aa 33-48), and a 197 aa mature region that shows one collagen-like domain (aa 59-92). Proteolytic processing may generate multiple CTHRC1 isoforms. There is the potential for an intracellular full-length 33 kDa, 245 aa form, plus extracellular isoforms that are 28 kDa (aa 33-245), 26 kDa (aa 49-245), 20 kDa (aa 98-245) and 18 kDa and 16 kDa in size, the last two representing variants of the 20 kDa form with C-terminal processing. CTHRC1 may undergo dimerization, trimerization and oligomerization. One mouse splice variant shows a deletion of aa 53-126. Full-length mouse CTHRC1 shares 99% and 93% aa sequence identity with rat and human CTHRC1, respectively.
CTHRC1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-98466
Loading...
Key Product Details
Species Reactivity
Mouse
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen for this antibody is Cthrc1 - C-terminal region. Peptide sequence HRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEEL. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for CTHRC1 Antibody - BSA Free
Western Blot: CTHRC1 Antibody [NBP1-98466]
Western Blot: CTHRC1 Antibody [NBP1-98466] - Mouse Brain Lysate 1.0ug/ml, Gel Concentration: 12%Applications for CTHRC1 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: CTHRC1
Long Name
Collagen Triple Helix Repeat Containing 1
Alternate Names
NMTC1
Gene Symbol
CTHRC1
UniProt
Additional CTHRC1 Products
Product Documents for CTHRC1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CTHRC1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for CTHRC1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review CTHRC1 Antibody - BSA Free and earn rewards!
Have you used CTHRC1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...