CTHRC1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98466

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen for this antibody is Cthrc1 - C-terminal region. Peptide sequence HRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEEL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CTHRC1 Antibody - BSA Free

Western Blot: CTHRC1 Antibody [NBP1-98466]

Western Blot: CTHRC1 Antibody [NBP1-98466]

Western Blot: CTHRC1 Antibody [NBP1-98466] - Mouse Brain Lysate 1.0ug/ml, Gel Concentration: 12%

Applications for CTHRC1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CTHRC1

CTHRC1 (Collagen triple helix repeat-containing protein 1) is a 28-30 kDa, secreted glycoprotein that bears similarity to the C1q/TNFalpha-related family of proteins. It is expressed by disparate cell types, including renal epithelium, neurons, osteoblasts, and smooth muscle cells. Functionally, it is recognized to be induced by BMP-2 and to block TGF beta-induced collagen type I and III synthesis. Mouse CTHRC1 is 245 amino acids in length. It contains a 32 amino acid (aa) signal sequence, a 16 aa prosegment (aa 33-48), and a 197 aa mature region that shows one collagen-like domain (aa 59-92). Proteolytic processing may generate multiple CTHRC1 isoforms. There is the potential for an intracellular full-length 33 kDa, 245 aa form, plus extracellular isoforms that are 28 kDa (aa 33-245), 26 kDa (aa 49-245), 20 kDa (aa 98-245) and 18 kDa and 16 kDa in size, the last two representing variants of the 20 kDa form with C-terminal processing. CTHRC1 may undergo dimerization, trimerization and oligomerization. One mouse splice variant shows a deletion of aa 53-126. Full-length mouse CTHRC1 shares 99% and 93% aa sequence identity with rat and human CTHRC1, respectively.

Long Name

Collagen Triple Helix Repeat Containing 1

Alternate Names

NMTC1

Gene Symbol

CTHRC1

Additional CTHRC1 Products

Product Documents for CTHRC1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CTHRC1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for CTHRC1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CTHRC1 Antibody - BSA Free and earn rewards!

Have you used CTHRC1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...