CTP synthase Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-52892

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CTP Synthase/CTPS1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CTPS(CTP synthase) The peptide sequence was selected from the N terminal of CTPS. Peptide sequence SMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

67 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CTP synthase Antibody - BSA Free

Western Blot: CTP synthase Antibody [NBP1-52892]

Western Blot: CTP synthase Antibody [NBP1-52892]

Western Blot: CTP synthase Antibody [NBP1-52892] - Lanes: 1 : 45ug human capan1 cell lysate Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit HRP Secondary, Antibody Dilution: 1 : 5000 Gene name: CTPS.
Immunohistochemistry-Paraffin: CTP synthase Antibody [NBP1-52892]

Immunohistochemistry-Paraffin: CTP synthase Antibody [NBP1-52892]

Immunohistochemistry-Paraffin: CTP synthase Antibody [NBP1-52892] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.
Western Blot: CTP synthase Antibody [NBP1-52892]

Western Blot: CTP synthase Antibody [NBP1-52892]

Western Blot: CTP synthase Antibody [NBP1-52892] - 721B tissue lysate at a concentration of 5ug/ml.

Applications for CTP synthase Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Reviewed Applications

Read 1 review rated 3 using NBP1-52892 in the following applications:

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CTP Synthase/CTPS1

The catalytic conversion of UTP to CTP is accomplished by the enzyme cytidine-5-prime-triphosphate synthetase. The enzyme is important in the biosynthesis of phospholipids and nucleic acids, and plays a key role in cell growth, development, and tumorigenesis.The catalytic conversion of UTP to CTP is accomplished by the enzyme cytidine-5-prime-triphosphate synthetase. The enzyme is important in the biosynthesis of phospholipids and nucleic acids, and plays a key role in cell growth, development, and tumorigenesis. The region to which the CTPS gene has been mapped is the location of breakpoints involved in several tumor types.The catalytic conversion of UTP to CTP is accomplished by the enzyme cytidine-5-prime-triphosphate synthetase. The enzyme is important in the biosynthesis of phospholipids and nucleic acids, and plays a key role in cell growth, development, and tumorigenesis. The region to which the CTPS gene has been mapped is the location of breakpoints involved in several tumor types.

Long Name

Cytidine 5'-Triphosphate Synthetase

Alternate Names

CTP Synthase 1, GATD5, IMD24

Gene Symbol

CTPS1

UniProt

P17812 (Human)

Additional CTP Synthase/CTPS1 Products

Product Documents for CTP synthase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CTP synthase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for CTP synthase Antibody - BSA Free

Customer Reviews for CTP synthase Antibody - BSA Free (1)

3 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
0%
3 Stars
100%
2 Stars
0%
1 Stars
0%

Have you used CTP synthase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • Name: Anonymous
    Application: Western Blot
    Sample Tested: cell line; MCF10A and MDAMB231
    Species: Human
    Verified Customer | Posted 11/30/2015
    MCF10A (first 3 lanes) and MDAMB231 (last 3 lanes)
    CTP synthase Antibody - BSA Free NBP1-52892

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies