CTPS2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84731

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all CTPS2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of CTPS2. Peptide sequence: AKRENFCNIHVSLVPQLSATGEQKTKPTQNSVRALRGLGLSPDLIVCRSS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CTPS2 Antibody - BSA Free

Western Blot: CTPS2 Antibody [NBP2-84731]

Western Blot: CTPS2 Antibody [NBP2-84731]

Western Blot: CTPS2 Antibody [NBP2-84731] - WB Suggested Anti-CTPS2 Antibody. Titration: 1.0 ug/ml. Positive Control: Hela Whole CellCTPS2 is supported by BioGPS gene expression data to be expressed in HeLa
Immunohistochemistry: CTPS2 Antibody [NBP2-84731]

Immunohistochemistry: CTPS2 Antibody [NBP2-84731]

Immunohistochemistry: CTPS2 Antibody [NBP2-84731] - Sample Type: Human Hep-2 cells. Primary Antibody Dilution: 1:500. Secondary Antibody: Goat anti-rabbit-Alexa Fluor 568. Secondary Antibody Dilution: 1:400. Color/Signal Descriptions: Red: CTPS2 Blue: DAPI. Gene Name: CTPS2. Submitted by: S. John Calise, Edward Chan Lab, University of Florida

Applications for CTPS2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CTPS2

The protein encoded by the CTPS2 gene catalyzes the formation of CTP from UTP with the concomitant deamination of glutamineto glutamate. This protein is the rate-limiting enzyme in the synthesis of cytosine nucleotides, which play animportant role in various metabolic processes and provide the precursors necessary for the synthesis of RNA and DNA.Cancer cells that exhibit increased cell proliferation also exhibit an increased activity of this encoded protein.Thus, this protein is an attractive target for selective chemotherapy. Three alternatively spliced transcript variantsencoding the same protein have been described for this gene. (provided by RefSeq)

Alternate Names

CTP synthase 2, CTP synthase II, CTP synthetase 2, CTP synthetase isoform, CTP synthetase type 2, cytidine 5'-triphosphate synthetase 2, DKFZp686C17207, EC 6.3.4.2, FLJ43358, MGC32997, UTP-ammonia ligase, UTP--ammonia ligase 2

Gene Symbol

CTPS2

Additional CTPS2 Products

Product Documents for CTPS2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CTPS2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CTPS2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CTPS2 Antibody - BSA Free and earn rewards!

Have you used CTPS2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies