CTPS2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17826

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CTPS2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RVPVLLEEQSIVKYFKERLHLPIGDSASNLLFKWRNMADRYERLQKICSIA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CTPS2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: CTPS2 Antibody [NBP3-17826]

Immunocytochemistry/ Immunofluorescence: CTPS2 Antibody [NBP3-17826]

Immunocytochemistry/Immunofluorescence: CTPS2 Antibody [NBP3-17826] - Staining of human cell line SiHa shows localization to cytosol & mitochondria.

Applications for CTPS2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CTPS2

The protein encoded by the CTPS2 gene catalyzes the formation of CTP from UTP with the concomitant deamination of glutamineto glutamate. This protein is the rate-limiting enzyme in the synthesis of cytosine nucleotides, which play animportant role in various metabolic processes and provide the precursors necessary for the synthesis of RNA and DNA.Cancer cells that exhibit increased cell proliferation also exhibit an increased activity of this encoded protein.Thus, this protein is an attractive target for selective chemotherapy. Three alternatively spliced transcript variantsencoding the same protein have been described for this gene. (provided by RefSeq)

Alternate Names

CTP synthase 2, CTP synthase II, CTP synthetase 2, CTP synthetase isoform, CTP synthetase type 2, cytidine 5'-triphosphate synthetase 2, DKFZp686C17207, EC 6.3.4.2, FLJ43358, MGC32997, UTP-ammonia ligase, UTP--ammonia ligase 2

Gene Symbol

CTPS2

Additional CTPS2 Products

Product Documents for CTPS2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CTPS2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CTPS2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CTPS2 Antibody - BSA Free and earn rewards!

Have you used CTPS2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies