CYB561D1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82788

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all CYB561D1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human CYB561D1. Peptide sequence: TGPLMEDRSEGGRARWVMPEIPALWEADAGGSLEVFSPGTLYSWPWRSA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CYB561D1 Antibody - BSA Free

Western Blot: CYB561D1 Antibody [NBP2-82788]

Western Blot: CYB561D1 Antibody [NBP2-82788]

Western Blot: CYB561D1 Antibody [NBP2-82788] - Host: Rabbit. Target Name: CYB561D1. Sample Type: COLO205 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for CYB561D1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CYB561D1

CYB561D1 is a gene that codes for a protein that binds two heme groups non-covalently and has 5 isoforms that have lengths of 229, 133, 251, 128, and 172 amino acids and weights of approximately 25, 14, 28, 14, and 19 kDa respectively. Current research is being done on diseases and disorders related to this gene including major depressive disorder and kidney disease.

Alternate Names

cytochrome b-561 domain containing 1, cytochrome b561 domain-containing protein 1, FLJ39035, FLJ44753, MGC138204

Gene Symbol

CYB561D1

Additional CYB561D1 Products

Product Documents for CYB561D1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CYB561D1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CYB561D1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CYB561D1 Antibody - BSA Free and earn rewards!

Have you used CYB561D1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies