During the G1 phase of the cell cycle, a cell must choose between rest and cell division. A small subfamily of cyclin family molecules, termed cyclin D proteins (D1, D2, D3), promotes commitment to mitosis. They accomplish this by interacting with cyclin-dependent kinases (cdk4 and cdk6) to generate Ser/Thr kinase complexes that remove blocks on DNA synthesis.
Cyclin D3 Antibody - Azide and BSA Free
Novus Biologicals | Catalog # NBP2-92937
Loading...
Key Product Details
Validated by
Knockout/Knockdown
Species Reactivity
Human, Mouse
Applications
Knockout Validated, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 201-292 of human Cyclin D3 (NP_001751.1). SMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Cyclin D3 Antibody - Azide and BSA Free
Western Blot: Cyclin D3 AntibodyAzide and BSA Free [NBP2-92937]
Western Blot: Cyclin D3 Antibody [NBP2-92937] - Analysis of extracts of various cell lines, using Cyclin D3 at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.Western Blot: Cyclin D3 Antibody - Azide and BSA Free [NBP2-92937]
Western Blot: Cyclin D3 Antibody [NBP2-92937] - Analysis of extracts from normal (control) and CCND3 knockout (KO) HeLa cells, using Cyclin D3 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk inApplications for Cyclin D3 Antibody - Azide and BSA Free
Application
Recommended Usage
Western Blot
1:500 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
Azide and BSA Free
Preservative
0.01% Thimerosal
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Cyclin D3
Alternate Names
CCND3
Gene Symbol
CCND3
Additional Cyclin D3 Products
Product Documents for Cyclin D3 Antibody - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Cyclin D3 Antibody - Azide and BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.govRelated Research Areas
Customer Reviews for Cyclin D3 Antibody - Azide and BSA Free
There are currently no reviews for this product. Be the first to review Cyclin D3 Antibody - Azide and BSA Free and earn rewards!
Have you used Cyclin D3 Antibody - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...