Cyclin D3 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-92937

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse

Applications

Knockout Validated, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 201-292 of human Cyclin D3 (NP_001751.1). SMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Cyclin D3 Antibody - Azide and BSA Free

Western Blot: Cyclin D3 AntibodyAzide and BSA Free [NBP2-92937]

Western Blot: Cyclin D3 AntibodyAzide and BSA Free [NBP2-92937]

Western Blot: Cyclin D3 Antibody [NBP2-92937] - Analysis of extracts of various cell lines, using Cyclin D3 at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.
Knockout Validated: Cyclin D3 Antibody - Azide and BSA Free [NBP2-92937]

Western Blot: Cyclin D3 Antibody - Azide and BSA Free [NBP2-92937]

Western Blot: Cyclin D3 Antibody [NBP2-92937] - Analysis of extracts from normal (control) and CCND3 knockout (KO) HeLa cells, using Cyclin D3 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in

Applications for Cyclin D3 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Cyclin D3

During the G1 phase of the cell cycle, a cell must choose between rest and cell division. A small subfamily of cyclin family molecules, termed cyclin D proteins (D1, D2, D3), promotes commitment to mitosis. They accomplish this by interacting with cyclin-dependent kinases (cdk4 and cdk6) to generate Ser/Thr kinase complexes that remove blocks on DNA synthesis.

Alternate Names

CCND3

Gene Symbol

CCND3

Additional Cyclin D3 Products

Product Documents for Cyclin D3 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Cyclin D3 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for Cyclin D3 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Cyclin D3 Antibody - Azide and BSA Free and earn rewards!

Have you used Cyclin D3 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies