CYP2S1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84748

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all CYP2S1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CYP2S1. Peptide sequence: MKYPHVQKWVREELNRELGAGQAPSLGDRTRLPYTDAVLHEAQRLLALVP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CYP2S1 Antibody - BSA Free

Western Blot: CYP2S1 Antibody [NBP2-84748]

Western Blot: CYP2S1 Antibody [NBP2-84748]

Western Blot: CYP2S1 Antibody [NBP2-84748] - WB Suggested Anti-CYP2S1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: ACHN cell lysate

Applications for CYP2S1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CYP2S1

The CYP2S1 gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein local

Alternate Names

CYPIIS1, cytochrome P450 2S1, cytochrome P450 family member predicted from ESTs, cytochrome P450, family 2, subfamily S, polypeptide 1, cytochrome P450, subfamily IIS, polypeptide 1, cytochrome P540, subfamily IIS, polypeptide 1, EC 1.14.14.1

Gene Symbol

CYP2S1

Additional CYP2S1 Products

Product Documents for CYP2S1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CYP2S1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CYP2S1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CYP2S1 Antibody - BSA Free and earn rewards!

Have you used CYP2S1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies