CYP2W1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84749

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all CYP2W1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CYP2W1. Peptide sequence: PVCSYVDALIQQGQGDDPEGLFAEANAVACTLDMVMAGTETTSATLQWAA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CYP2W1 Antibody - BSA Free

Western Blot: CYP2W1 Antibody [NBP2-84749]

Western Blot: CYP2W1 Antibody [NBP2-84749]

Western Blot: CYP2W1 Antibody [NBP2-84749] - WB Suggested Anti-CYP2W1 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Lung
Western Blot: CYP2W1 Antibody [NBP2-84749]

Western Blot: CYP2W1 Antibody [NBP2-84749]

Western Blot: CYP2W1 Antibody [NBP2-84749] - Western Blot analysis using CYP2W1 Antibody [NBP2-84749]. Titration: 1.0 ug/ml.Positive Control: Fetal Lung

Applications for CYP2W1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CYP2W1

The CYP2W1 gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins aremonooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids andother lipids. (provided by RefSeq)

Long Name

Cytochrome P450 2W1

Alternate Names

CYPIIW1, EC 1.14.14.-

Gene Symbol

CYP2W1

Additional CYP2W1 Products

Product Documents for CYP2W1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CYP2W1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CYP2W1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CYP2W1 Antibody - BSA Free and earn rewards!

Have you used CYP2W1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies