Cystathionase Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-52849

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human, Mouse, Rat

Applications

Validated:

Western Blot, Immunoprecipitation

Cited:

Western Blot, Immunoprecipitation, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Cystathionase Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CTH(cystathionase (cystathionine gamma-lyase)) The peptide sequence was selected from the N terminal of human CTH. Peptide sequence VPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAF. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Rat and Mouse reactivity reported in scientific literature (PMID: 25900831). Rat reactivity reported in scientific literature (PMID: 27531649).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Cystathionase Antibody - BSA Free

Western Blot: Cystathionase Antibody [NBP1-52849]

Western Blot: Cystathionase Antibody [NBP1-52849]

Western Blot: Cystathionase Antibody [NBP1-52849] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.
Western Blot: Cystathionase Antibody [NBP1-52849]

Western Blot: Cystathionase Antibody [NBP1-52849]

Western Blot: Cystathionase Antibody [NBP1-52849] - CSE expression in wild type HEK293 cell (lane 1) or CSE overexpressed HEK293 (lane 2) whole cell lysate. Image from verified customer review.

Applications for Cystathionase Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml
Application Notes
Use in Immunoprecipitation reported in scientific literature (PMID 25900831).

Reviewed Applications

Read 3 reviews rated 5 using NBP1-52849 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cystathionase

CTH is a cytoplasmic enzyme in the trans-sulfuration pathway that converts cystathione derived from methionine into cysteine. Glutathione synthesis in the liver is dependent upon the availability of cysteine. Mutations in its gene cause cystathioninuria.This gene encodes a cytoplasmic enzyme in the trans-sulfuration pathway that converts cystathione derived from methionine into cysteine. Glutathione synthesis in the liver is dependent upon the availability of cysteine. Mutations in this gene cause cystathioninuria. Alternative splicing of this gene results in two transcript variants encoding different isoforms.

Alternate Names

cystathionase (cystathionine gamma-lyase), cystathionine gamma-lyase, cysteine desulfhydrase, EC 4.4.1, EC 4.4.1.1, gamma-cystathionase, homoserine deaminase, homoserine dehydratase, MGC9471

Entrez Gene IDs

1491 (Human)

Gene Symbol

CTH

UniProt

P32929 (Human)

Additional Cystathionase Products

Product Documents for Cystathionase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Cystathionase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Cystathionase Antibody - BSA Free

Customer Reviews for Cystathionase Antibody - BSA Free (3)

5 out of 5
3 Customer Ratings
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Cystathionase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card
Showing  1 - 3 of 3 reviews Showing All
Filter By:
Clear Filters X
  • Cystathionase Antibody
    Name: Anonymous
    Application: Western Blot
    Sample Tested: Rat whole liver lysate
    Species: Other
    Verified Customer | Posted 09/08/2014
  • Cystathionase Antibody
    Name: Anonymous
    Application: Western Blot
    Sample Tested: HEK293 whole cell lysate
    Species: Other
    Verified Customer | Posted 05/06/2014
  • Cystathionase Antibody
    Name: Anonymous
    Application: Western Blot
    Sample Tested: HEK293 whole cell lysate
    Species: Other
    Verified Customer | Posted 05/02/2014

There are no reviews that match your criteria.

Showing  1 - 3 of 3 reviews Showing All

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies