Cytochrome P450 2C9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84753

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Cytochrome P450 2C9 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human Cytochrome P450 2C9. Peptide sequence: AGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVPPFYQLCFIPV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Cytochrome P450 2C9 Antibody - BSA Free

Western Blot: Cytochrome P450 2C9 Antibody [NBP2-84753]

Western Blot: Cytochrome P450 2C9 Antibody [NBP2-84753]

Western Blot: Cytochrome P450 2C9 Antibody [NBP2-84753] - WB Suggested Anti-CYP2C9 Antibody Titration: 0.2-1 ug/ml. Positive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that CYP2C9 is expressed in Jurkat

Applications for Cytochrome P450 2C9 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cytochrome P450 2C9

The Cytochrome P450 2C9 gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins aremonooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids andother lipids. This protein localiz

Long Name

Cytochrome P450 2C9

Alternate Names

CYP2C10, CYP2C9, CYPIIC9, Cytochrome P-450MP

Gene Symbol

CYP2C9

Additional Cytochrome P450 2C9 Products

Product Documents for Cytochrome P450 2C9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Cytochrome P450 2C9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cytochrome P450 2C9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cytochrome P450 2C9 Antibody - BSA Free and earn rewards!

Have you used Cytochrome P450 2C9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies