Cytokeratin 6a Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98517

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen for this antibody is Cytokeratin 6a - C-terminal region. Peptide sequence IIAEVKAQYEEIAQRSRAEAESWYQTKYEELQVTAGRHGDDLRNTKQEIA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Cytokeratin 6a Antibody - BSA Free

Western Blot: Cytokeratin 6a Antibody [NBP1-98517]

Western Blot: Cytokeratin 6a Antibody [NBP1-98517]

Western Blot: Cytokeratin 6a Antibody [NBP1-98517] - MCF7 Cell Lysate 1.0ug/ml, Gel Concentration: 12%

Applications for Cytokeratin 6a Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cytokeratin 6a

The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. As many as six of this type II cytokeratin (KRT6) have been identified; the multiplicity of the genes is attributed to successive gene duplication events. The genes are expressed with family members KRT16 and/or KRT17 in the filiform papillae of the tongue, the stratified epithelial lining of oral mucosa and esophagus, the outer root sheath of hair follicles, and the glandular epithelia. This KRT6 gene in particular encodes the most abundant isoform. Mutations in these genes have been associated with pachyonychia congenita. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.

Alternate Names

Allergen Hom s 5, CK6A, CK-6A, CK6C, CK6D, CK-6D, cytokeratin 6A, cytokeratin 6C, cytokeratin 6D, Cytokeratin-6A, Cytokeratin-6D, K6A, K6C, K6D, keratin 6A, keratin 6C, keratin 6D, keratin, epidermal type II, K6A, keratin, type II cytoskeletal 6A, Keratin-6A, KRT6C, KRT6D, Type-II keratin Kb6

Gene Symbol

KRT6A

Additional Cytokeratin 6a Products

Product Documents for Cytokeratin 6a Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Cytokeratin 6a Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cytokeratin 6a Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cytokeratin 6a Antibody - BSA Free and earn rewards!

Have you used Cytokeratin 6a Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...