DAX1/NR0B1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-68852

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DAX1/NR0B1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: LKSPQVVCEAASAGLLKTLRFVKYLPCFQVLPLDQQLVLVRNCWASLLMLELAQDRLQFETVEVSEPSMLQKILTT

Reactivity Notes

Rat 80%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DAX1/NR0B1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: DAX1/NR0B1 Antibody [NBP2-68852]

Immunocytochemistry/ Immunofluorescence: DAX1/NR0B1 Antibody [NBP2-68852]

Immunocytochemistry/Immunofluorescence: DAX1/NR0B1 Antibody [NBP2-68852] - Staining of human cell line RT4 shows localization to nuclear speckles & microtubule organizing center.
DAX1/NR0B1 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: DAX1/NR0B1 Antibody - BSA Free [NBP2-68852]

Chromatin Immunoprecipitation-exo-Seq: DAX1/NR0B1 Antibody - BSA Free [NBP2-68852]

ChIP-Exo-Seq composite graph for Anti-NR0B1 (NBP2-68852) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for DAX1/NR0B1 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DAX1/NR0B1

NR0B1 encodes a protein that contains a DNA-binding domain. The encoded protein acts as a dominant-negative regulator of transcription which is mediated by the retinoic acid receptor. This protein also functions as an anti-testis gene by acting antagonistically to Sry. Mutations in this gene result in both X-linked congenital adrenal hypoplasia and hypogonadotropic hypogonadism.

Long Name

Orphan Nuclear Receptor DAX1/Nuclear Receptor Subfamily 0, Group B, Member 1

Alternate Names

AHC, AHCH, NR0B1

Gene Symbol

NR0B1

Additional DAX1/NR0B1 Products

Product Documents for DAX1/NR0B1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DAX1/NR0B1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DAX1/NR0B1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DAX1/NR0B1 Antibody - BSA Free and earn rewards!

Have you used DAX1/NR0B1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies