DDX11 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38060

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DDX11 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: KREEEARLLETGTGPLHDEKDESLCLSSSCEGAAGTPRPAGEPAWVTQFVQKKEERDLV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DDX11 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: DDX11 Antibody [NBP2-38060]

Immunocytochemistry/ Immunofluorescence: DDX11 Antibody [NBP2-38060]

Immunocytochemistry/Immunofluorescence: DDX11 Antibody [NBP2-38060] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus.
Immunohistochemistry-Paraffin: DDX11 Antibody [NBP2-38060]

Immunohistochemistry-Paraffin: DDX11 Antibody [NBP2-38060]

Immunohistochemistry-Paraffin: DDX11 Antibody [NBP2-38060] - Staining of human small intestine shows strong nuclear positivity in lymphoid and glandular cells.
Immunohistochemistry-Paraffin: DDX11 Antibody [NBP2-38060]

Immunohistochemistry-Paraffin: DDX11 Antibody [NBP2-38060]

Immunohistochemistry-Paraffin: DDX11 Antibody [NBP2-38060] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: DDX11 Antibody [NBP2-38060]

Immunohistochemistry-Paraffin: DDX11 Antibody [NBP2-38060]

Immunohistochemistry-Paraffin: DDX11 Antibody [NBP2-38060] - Staining of human lymph node shows moderate nuclear positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: DDX11 Antibody [NBP2-38060]

Immunohistochemistry-Paraffin: DDX11 Antibody [NBP2-38060]

Immunohistochemistry-Paraffin: DDX11 Antibody [NBP2-38060] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.

Applications for DDX11 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DDX11

DDX11, also known as Probable ATP-dependent RNA helicase DDX11, consists of five isoforms of sizes of 108.3 kDa, 101.7 kDa, 98.7 kDa, 96.1 kDa, and 33 kDa and is involved in cellular proliferation and alteration of RNA secondary structure. Current research is being conducted for diseases and disorders including anemia, carcinoma, malaria, coloboma, and Roberts syndrome. The protein interacts in metabolism of proteins and unfolded protein response pathways with KAT7, FEN1, PCNA, PFN2, and RFC2.

Alternate Names

CHL1CHL1-related helicase gene-1, CHL1-related protein 1, CHLR1MGC9335, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11 (CHL1-like helicase homolog, S.cerevisiae), DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11 (S.cerevisiae CHL1-likehelicase), DEAD/H box protein 11, EC 3.6.1, EC 3.6.1.23, EC 3.6.1.7, EC 3.6.4.13, hCHLR1, Keratinocyte growth factor-regulated gene 2 protein, KRG-2, KRG2CHL1-like helicase homolog, MGC133249, probable ATP-dependent RNA helicase DDX11

Gene Symbol

DDX11

UniProt

Q96FC9 (Human)

Additional DDX11 Products

Product Documents for DDX11 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DDX11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DDX11 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DDX11 Antibody - BSA Free and earn rewards!

Have you used DDX11 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies