DDX51 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87263

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all DDX51 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DDX51. Peptide sequence: FNIYTDATPLRVSLVTGQKSLAKEQESLVQKTADGYRCLADIVVATPGRL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for DDX51 Antibody - BSA Free

Western Blot: DDX51 Antibody [NBP2-87263]

Western Blot: DDX51 Antibody [NBP2-87263]

Western Blot: DDX51 Antibody [NBP2-87263] - WB Suggested Anti-DDX51 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: 293T cell lysate

Applications for DDX51 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DDX51

DDX51 is a member of the DEAD box family of proteins that possesses several conserved motifs which include the highly conserved DEAD (Asp-Glu-Ala-Asp) amino acid sequence motif. The major activity of DEAD box proteins is to function as ATP-dependent RNA helicases. As helicases, DEAD proteins play an important role in all aspects of RNA metabolism and function which include pre-mRNA splicing, RNA synthesis, RNA degradation, RNA export, RNA translation, RNA secondary structure formation, ribosome biogenesis, and the assembly of RNP complexes. DDX51 may function in biogenesis of the 60S ribosomal subunit. Alternate names for DDX51 include ATP-dependent RNA helicase DDX51, DEAD box protein 51, MGC42193, and DKFZp686N2081.

Alternate Names

ATP-dependent RNA helicase DDX51, DEAD (Asp-Glu-Ala-Asp) box polypeptide 51, DEAD box protein 51, DKFZp686N2081, EC 3.6.1, EC 3.6.4.13, MGC42193

Gene Symbol

DDX51

Additional DDX51 Products

Product Documents for DDX51 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DDX51 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DDX51 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DDX51 Antibody - BSA Free and earn rewards!

Have you used DDX51 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies