Defensin alpha 5 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-03835

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all alpha-Defensin 5 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 20-94 of human Defensin alpha 5 (NP_066290.1). ESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTGRCATRESLSGVCEISGRLYRLCCR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

10 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Defensin alpha 5 Antibody - Azide and BSA Free

Western Blot: Defensin alpha 5 AntibodyAzide and BSA Free [NBP3-03835]

Western Blot: Defensin alpha 5 AntibodyAzide and BSA Free [NBP3-03835]

Western Blot: Defensin alpha 5 Antibody [NBP3-03835] - Western blot analysis of extracts of HCT116 cells, using Defensin alpha 5 antibody (NBP3-03835) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Applications for Defensin alpha 5 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: alpha-Defensin 5

Defensin alpha 5 (DEFA5) is primarily responsible for host defense. DEFA5 has shown antimicrobial activity and is thought to kill microbes by permeabilizing their plasma membrane. This protein is highly expressed in the secretory granules of Paneth cells of the ileum.

Defensin alpha 5 antibodies are useful tools for bacterial defense studies and human immunology research.

Long Name

Defensin Alpha 5

Alternate Names

DEF5, DEFA5, Defensin alpha 5, HD-5

Gene Symbol

DEFA5

Additional alpha-Defensin 5 Products

Product Documents for Defensin alpha 5 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Defensin alpha 5 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Defensin alpha 5 Antibody - Azide and BSA Free

Customer Reviews for Defensin alpha 5 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Defensin alpha 5 Antibody - Azide and BSA Free and earn rewards!

Have you used Defensin alpha 5 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies