DEGS2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10844

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all DEGS2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse DEGS2 (NP_001164473.1). Peptide sequence TFNVGYHMEHHDFPSIPGYYLPLVRKIAPEYYDHLPQHHSWVKVLWDFVF

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for DEGS2 Antibody - BSA Free

Western Blot: DEGS2 Antibody [NBP3-10844]

Western Blot: DEGS2 Antibody [NBP3-10844]

Western Blot: DEGS2 Antibody [NBP3-10844] - Western blot analysis of DEGS2 in Mouse Kidney lysates. Antibody dilution at 1ug/ml

Applications for DEGS2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DEGS2

The DEGS2 gene encodes a bifunctional enzyme that is involved in the biosynthesis of phytosphingolipids in human skin and in other phytosphingolipid-containing tissues. This enzyme can act as a sphingolipid delta(4)-desaturase, and also as a sphingolipid C4-hy

Alternate Names

C14orf66, chromosome 14 open reading frame 66, Degenerative spermatocyte homolog 2, degenerative spermatocyte homolog 2, lipid desaturase (Drosophila), DES2sphingolipid delta(4)-desaturase/C4-hydroxylase DES2, EC 1.14, FADS8, sphingolipid C4-hydroxylase/delta 4-desaturase, sphingolipid delta 4 desaturase/C-4 hydroxylase

Gene Symbol

DEGS2

Additional DEGS2 Products

Product Documents for DEGS2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DEGS2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DEGS2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DEGS2 Antibody - BSA Free and earn rewards!

Have you used DEGS2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies