Dematin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84768

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human Dematin. Peptide sequence: KGRTKLPPGVDRMRLERHLSAEDFSRVFAMSPEEFGKLALWKRNELKKKA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Dematin Antibody - BSA Free

Western Blot: Dematin Antibody [NBP2-84768]

Western Blot: Dematin Antibody [NBP2-84768]

Western Blot: Dematin Antibody [NBP2-84768] - Host: Rabbit. Target Name: DMTN. Sample Type: Hela Whole cell lysates. Antibody Dilution: 1.0ug/ml

Applications for Dematin Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Dematin

Caldesmon, filamin 1, nebulin, villin, plastin, ADF, gelsolin, Dematin, and cofilin are differentially expressed actin binding proteins. Dematin is a bundling protein of the erythrocyte membrane skeleton. Dematin is localized to the spectrin-actin junctions, and its actin-bundling activity is abolished upon phosphorylation by cAMP-dependent protein kinase. It may also play a role in the regulation of cell shape, implying a role in tumorigenesis. Dematin is a trimeric protein containing two subunits of 48 kDa and one subunit of 52 kDa. It is localized to the heart, brain, lung, skeletal muscle, and kidney. The Dematin gene is located on human chromosome 8p21.1, a region frequently deleted in prostate cancer, and mouse chromosome 14.

Alternate Names

dematin, DMTFLJ78462, Erythrocyte membrane protein band 4.9, erythrocyte membrane protein band 4.9 (dematin), FLJ98848

Gene Symbol

EPB49

Additional Dematin Products

Product Documents for Dematin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Dematin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Dematin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Dematin Antibody - BSA Free and earn rewards!

Have you used Dematin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...