DEPDC1A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84002

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all DEPDC1A Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DEPDC1A. Peptide sequence: PEPLLTFEYYELFVNILVVCGYITVSDRSSGIHKIQDDPQSSKFLHLNNL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for DEPDC1A Antibody - BSA Free

Western Blot: DEPDC1A Antibody [NBP2-84002]

Western Blot: DEPDC1A Antibody [NBP2-84002]

Western Blot: DEPDC1A Antibody [NBP2-84002] - Host: Rabbit. Target Name: HIRIP3. Sample Type: 293T. Antibody Dilution: 1.0ug/mlDEPDC1 is supported by BioGPS gene expression data to be expressed in HEK293T
Western Blot: DEPDC1A Antibody [NBP2-84002]

Western Blot: DEPDC1A Antibody [NBP2-84002]

Western Blot: DEPDC1A Antibody [NBP2-84002] - WB Suggested Anti-DEPDC1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: Human brain
Western Blot: DEPDC1A Antibody [NBP2-84002]

Western Blot: DEPDC1A Antibody [NBP2-84002]

Western Blot: DEPDC1A Antibody [NBP2-84002] - Host: Rabbit. Target Name: WT1. Sample Type: 721_B. Antibody Dilution: 1.0ug/mlDEPDC1 is supported by BioGPS gene expression data to be expressed in 721_B
Western Blot: DEPDC1A Antibody [NBP2-84002]

Western Blot: DEPDC1A Antibody [NBP2-84002]

Western Blot: DEPDC1A Antibody [NBP2-84002] - Host: Rabbit. Target Name: SERPINA3. Sample Type: Human Adult Placenta. Antibody Dilution: 1.0ug/ml
Western Blot: DEPDC1A Antibody [NBP2-84002]

Western Blot: DEPDC1A Antibody [NBP2-84002]

Western Blot: DEPDC1A Antibody [NBP2-84002] - Host: Rabbit. Target Name: EGFL8. Sample Type: Hela. Antibody Dilution: 1.0ug/mlDEPDC1 is supported by BioGPS gene expression data to be expressed in HeLa
Western Blot: DEPDC1A Antibody [NBP2-84002]

Western Blot: DEPDC1A Antibody [NBP2-84002]

Western Blot: DEPDC1A Antibody [NBP2-84002] - Host: Rabbit. Target Name: FAM46C. Sample Type: Human Fetal Liver. Antibody Dilution: 1.0ug/ml

Applications for DEPDC1A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DEPDC1A

DEPDC1a is a protein that is expressed frequently in bladder cancer cells. DEPDC1a is also significantly up-regulated in DCIS and IDC breast cancers. It seems to be important for the proliferation, as well as the migration and invasion, of cancer cells.

Alternate Names

cell cycle control protein SDP35, DEP domain containing 1,5830484J08Rik, DEP domain-containing protein 1A, DEP.8, DEPDC1ADEPDC1-V2, FLJ20354, SDP35

Gene Symbol

DEPDC1

Additional DEPDC1A Products

Product Documents for DEPDC1A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DEPDC1A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for DEPDC1A Antibody - BSA Free

Customer Reviews for DEPDC1A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DEPDC1A Antibody - BSA Free and earn rewards!

Have you used DEPDC1A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies