Dermcidin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-92673

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Mouse

Applications

Validated:

Western Blot

Cited:

Immunohistochemistry-Frozen

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Dermcidin Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human DCD (NP_444513.1). YDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Dermcidin Antibody - BSA Free

Dermcidin Antibody

Western Blot: Dermcidin Antibody [NBP2-92673] -

Western Blot: Dermcidin Antibody [NBP2-92673] - analysis of HeLa, using DCD antibody at 1:8000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 90s.
Dermcidin Antibody

Western Blot: Dermcidin Antibody [NBP2-92673] -

Western Blot: Dermcidin Antibody [NBP2-92673] - analysis of 293T, using DCD antibody at 1:8000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 90s.

Applications for Dermcidin Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:2000 - 1:9000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Dermcidin

Dermcidin is a protein that has three isoforms, with lengths of 110, 121, and 77 amino acids and weights of approximately 11, 12, and 8 kDa respectively. Dermcidin limits the skin infection of pathogens after a bacterial infection due to its antimicrobial activity as well as functions to aid in phosphatase activity and the survival of neurons. Current studies are being done on several diseases and disorders linked to this protein including clear cell hidradenoma, root caries, angiomyoma, skin conditions, myocardial infarction, hidrocystoma, atopic dermatitis, squamous cell carcinoma, vaginitis, breast cancer, lung cancer, and prostate cancer. Dermcidin has also been shown to have interactions with FAM107A, INPP5K, MDM2, TNFRSF14, and SUMO2.

Alternate Names

AIDDdiffusible survival/evasion peptide, DCD-1, dermcidin, DSEPpreproteolysin, HCAP, MGC71930, PIF, Preproteolysin, proteolysis inducing factor, survival promoting peptide

Gene Symbol

DCD

Additional Dermcidin Products

Product Documents for Dermcidin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Dermcidin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Dermcidin Antibody - BSA Free

Customer Reviews for Dermcidin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Dermcidin Antibody - BSA Free and earn rewards!

Have you used Dermcidin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies