Desmocollin-3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56621

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Desmocollin-3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PDFRVLNDGSVYTARAVALSDKKRSFTIWLSDKRKQTQKEVTVLLEHQKKVSKTRHTRET

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Desmocollin-3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Desmocollin-3 Antibody [NBP2-56621]

Immunocytochemistry/ Immunofluorescence: Desmocollin-3 Antibody [NBP2-56621]

Immunocytochemistry/Immunofluorescence: Desmocollin-3 Antibody [NBP2-56621] - Staining of human cell line U-2 OS shows localization to plasma membrane & cell junctions.

Applications for Desmocollin-3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Desmocollin-3

Desmocollin 3 is encoded by this gene is a calcium-dependent glycoprotein that is a member of the desmocollin subfamily of the cadherin superfamily. These desmosomal family members, along with the desmogleins, are found primarily in epithelial cells where they constitute the adhesive proteins of the desmosome cell-cell junction and are required for cell adhesion and desmosome formation. The desmosomal family members are arranged in two clusters on chromosome 18, occupying less than 650 kb combined. Alternative splicing results in two transcript variants encoding distinct isoforms.

Alternate Names

CDHF3, Desmocollin3, DSC3, DSC4, HT-CP

Gene Symbol

DSC3

Additional Desmocollin-3 Products

Product Documents for Desmocollin-3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Desmocollin-3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cadherin Superfamily

Customer Reviews for Desmocollin-3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Desmocollin-3 Antibody - BSA Free and earn rewards!

Have you used Desmocollin-3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies