DGCR2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59220

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to DGCR2(DiGeorge syndrome critical region gene 2) The peptide sequence was selected from the middle region of DGCR2. Peptide sequence AESCYEKSSFLCKRSQTCVDIKDNVVDEGFYFTPKGDDPCLSCTCHGGEP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for DGCR2 Antibody - BSA Free

Western Blot: DGCR2 Antibody [NBP1-59220]

Western Blot: DGCR2 Antibody [NBP1-59220]

Western Blot: DGCR2 Antibody [NBP1-59220] - Lanes: Lane 1: 75,000 rat INS1 cells Primary Antibody Dilution: 1:1000 Secondary Antibody: Anti rabbit-HRP Secondary Antibody Dilution: 1:1000 Gene Name: DGCR2 Submitted by: Benedich Bracleva, VUB, Universitair Ziekenhuis Brussel
Western Blot: DGCR2 Antibody [NBP1-59220]

Western Blot: DGCR2 Antibody [NBP1-59220]

Western Blot: DGCR2 Antibody [NBP1-59220] - Hela cell lysate, concentration 0.2-1 ug/ml.

Applications for DGCR2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DGCR2

Deletions of the 22q11.2 have been associated with a wide range of developmental defects classified under the acronym CATCH 22. The DGCR2 is a novel putative adhesion receptor protein, which could play a role in neural crest cells migration, a process which has been proposed to be altered in DiGeorge syndrome. Deletions of the 22q11.2 have been associated with a wide range of developmental defects (notably DiGeorge syndrome, velocardiofacial syndrome, conotruncal anomaly face syndrome and isolated conotruncal cardiac defects) classified under the acronym CATCH 22. The DGCR2 gene encodes a novel putative adhesion receptor protein, which could play a role in neural crest cells migration, a process which has been proposed to be altered in DiGeorge syndrome.

Long Name

DiGeorge Syndrome Critical Region Gene 2

Alternate Names

KIAA0163, SEZ-12

Gene Symbol

DGCR2

UniProt

Additional DGCR2 Products

Product Documents for DGCR2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DGCR2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DGCR2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DGCR2 Antibody - BSA Free and earn rewards!

Have you used DGCR2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...