DGKH Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87267

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DGKH. Peptide sequence: DLDSVDGYSEKCVMNNYFGIGLDAKISLEFNNKREEHPEKCRSRTKNLMW The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for DGKH Antibody - BSA Free

Western Blot: DGKH Antibody [NBP2-87267]

Western Blot: DGKH Antibody [NBP2-87267]

Western Blot: DGKH Antibody [NBP2-87267] - WB Suggested Anti-DGKH Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: Human heart
Immunohistochemistry: DGKH Antibody [NBP2-87267]

Immunohistochemistry: DGKH Antibody [NBP2-87267]

Immunohistochemistry: DGKH Antibody [NBP2-87267] - Sample Type: Adult mouse cortex. Primary Antibody Dilution: 1:500. Secondary Antibody: Anti-rabbit-Cy3. Secondary Antibody Dilution: 1:1000. Color/Signal Descriptions: Red: DGKH Cyan: Nissl (Neurons). Gene Name: DGKH. Submitted by: Joshua R. Sanes, Molecu
Western Blot: DGKH Antibody [NBP2-87267]

Western Blot: DGKH Antibody [NBP2-87267]

Western Blot: DGKH Antibody [NBP2-87267] - Host: Rabbit. Target: DGKH. Positive control (+): Human Brain (BR). Negative control (-): Human Fetal Heart (HE). Antibody concentration: 1ug/ml

Applications for DGKH Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DGKH

DGKH, also known as Diacylglycerol kinase eta, consists of four isoforms of sizes 134.9 kDa, 128 kDa, 122.4 kDa, and 120.6 kDa and is involved in activating the signaling pathway Ras/B-Raf/C-Raf/MEK/ERK in order to promote cell growth. Current research is exploring the effect of the protein on diseases and disorders such as measles, neuronitis, bipolar disorder, and schizophrenia. The protein interacts with AGPAT2, AGPAT4, CHPT1, ARRB1, and DGKD proteins while in hemostasis, signal transduction, and metabolic pathways.

Alternate Names

DAG kinase eta, DGKeta, DGK-eta, diacylglycerol kinase eta, diacylglycerol kinase, eta, Diglyceride kinase eta, DKFZp761I1510, EC 2.7.1.107

Gene Symbol

DGKH

Additional DGKH Products

Product Documents for DGKH Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DGKH Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DGKH Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DGKH Antibody - BSA Free and earn rewards!

Have you used DGKH Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...