DHX16 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87270

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all DHX16 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of DHX16. Peptide sequence: RREYLAKREREKLEDLEAELADEEFLFGDVELSRHERQELKYKRRVRDLA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for DHX16 Antibody - BSA Free

Western Blot: DHX16 Antibody [NBP2-87270]

Western Blot: DHX16 Antibody [NBP2-87270]

Western Blot: DHX16 Antibody [NBP2-87270] - WB Suggested Anti-DHX16 Antibody. Titration: 0.25 ug/ml. Positive Control: PANC1 Whole Cell

Applications for DHX16 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DHX16

DHX16, also known as Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16, is a 119.3 kDa 1,041 amino acid protein and is engaged in pre-mRNA splicing and unwinding RNA as a part of the DEAD box protein family. Current research is being conducted with the protein involving diseases such as adenocarcinoma, ataxia, esophagitis, erythematosus, and malaria. The protein interacts in mRNA processing and spliceosome pathways with other proteins such as GPKOW, SF3B2, COIL, DHX38, and MEGF10.

Alternate Names

ATP-dependent RNA helicase #3, DBP2PRO2014, DDX16DEAD/H box 16, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 16, DEAH (Asp-Glu-Ala-His) box polypeptide 16, DEAH-box protein 16, EC 3.6.1, EC 3.6.4.13, KIAA0577, Prp2, PRP8, PRPF2, putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16, RNA helicase

Gene Symbol

DHX16

Additional DHX16 Products

Product Documents for DHX16 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DHX16 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DHX16 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DHX16 Antibody - BSA Free and earn rewards!

Have you used DHX16 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies