DHX32 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57347

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DHX32 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to DHX32(DEAH (Asp-Glu-Ala-His) box polypeptide 32) The peptide sequence was selected from the N terminal of DHX32. Peptide sequence EEEGLECPNSSSEKRYFPESLDSSDGDEEEVLACEDLELNPFDGLPYSSR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for DHX32 Antibody - BSA Free

Western Blot: DHX32 Antibody [NBP1-57347]

Western Blot: DHX32 Antibody [NBP1-57347]

Western Blot: DHX32 Antibody [NBP1-57347] - Human Lung lysate, concentration 0.2-1 ug/ml.

Applications for DHX32 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DHX32

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX32 is a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates 2 transcript variants, but the full length nature of one of the variants has not been defined. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates 2 transcript variants, but the full length nature of one of the variants has not been defined.

Alternate Names

DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 32, DEAD/H box 32, DEAD/H helicase-like protein 1, DEAH (Asp-Glu-Ala-His) box polypeptide 32, DEAH box protein 32, DHLP1DDX32DEAD/H helicase-like protein-1, EC 3.6.1, EC 3.6.4.13, FLJ10694, FLJ10889, HuDDX32, putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32

Gene Symbol

DHX32

UniProt

Q7L7V1 (Human)

Additional DHX32 Products

Product Documents for DHX32 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DHX32 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DHX32 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DHX32 Antibody - BSA Free and earn rewards!

Have you used DHX32 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies