DISP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13925

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DISP1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: GKTNVHSLQRSIEEHLPKMAEPSSFVCRSTGSLLKTCCDPENKQRELCKNRDVSNLESSGGTENKAGGKVELSLSQTDASVNSE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DISP1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: DISP1 Antibody [NBP2-13925]

Immunocytochemistry/ Immunofluorescence: DISP1 Antibody [NBP2-13925]

Immunocytochemistry/Immunofluorescence: DISP1 Antibody [NBP2-13925] - Immunofluorescent staining of human cell line HEK 293 shows localization to nuclear bodies.
Immunohistochemistry-Paraffin: DISP1 Antibody [NBP2-13925]

Immunohistochemistry-Paraffin: DISP1 Antibody [NBP2-13925]

Immunohistochemistry-Paraffin: DISP1 Antibody [NBP2-13925] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.

Applications for DISP1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DISP1

The pattern of cellular proliferation and differentiation that leads to normal development of embryonic structuresoften depends upon the localized production of secreted protein signals. Cells surrounding the source of a particularsignal respond in a graded manner according to the effective concentration of the signal, and this response producesthe pattern of cell types constituting the mature structure. A novel segment-polarity gene known as dispatched hasbeen identified in Drosophila and its protein product is required for normal Hedgehog (Hh) signaling. This gene is oneof two human homologs of Drosophila dispatched and, based on sequence identity to its mouse counterpart, the encodedprotein may play an essential role in Hh patterning activities in the early embryo. (provided by RefSeq)

Long Name

Dispatched 1

Alternate Names

DISPA, Dispatched

Gene Symbol

DISP1

Additional DISP1 Products

Product Documents for DISP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DISP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DISP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DISP1 Antibody - BSA Free and earn rewards!

Have you used DISP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies