DKC1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-85156
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Predicted:
Mouse (99%), Rat (92%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Cited:
IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EAGTYIRTLCVHLGLLLGVGGQMQELRRVRSGVMSEKDHMVTMHDVLDAQWLYDNHKDESYLRRVVYPLEKLLTSHKRLVMKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVIT
Reactivity Notes
Reactivity reported in scientific literature (PMID: 23435261)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for DKC1 Antibody - BSA Free
Western Blot: DKC1 Antibody [NBP1-85156]
Western Blot: DKC1 Antibody [NBP1-85156] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human cell line A-431 Lane 5: Human liver tissue Lane 6: Human tonsil tissueImmunohistochemistry-Paraffin: DKC1 Antibody [NBP1-85156]
Immunohistochemistry-Paraffin: DKC1 Antibody [NBP1-85156] - Staining of human cerebral cortex shows strong nucleolar positivity in neuronal cells.Immunohistochemistry: DKC1 Antibody - BSA Free [NBP1-85156] -
Distinct immune microenvironments exist in CI and CII. (a) Comparisons of Lymphocytes Fraction (see Section 4) between two clusters in two CRC databases by different immune faction analysis, xcell, and ESTIMATE [31,32]. (b) Comparisons of Macrophages between two clusters in 2014 CPTAC CRC databases analyzed by three methods, xcell, CIBERSORT, and immune staining of CRC databases [31,33,34]. (c) Comparisons of Monocytes between two clusters in 2019 CPTAC CRC Label free databases analyzed by xcell. (d) The distribution of patients belonging to two clusters in four different immune subtypes from Thorsson et al., 2018, Immunity [35]. (e) Scatter diagram showing correlations of DKC1 protein expression with CD8+ Tcm cells in total patients in 2014 CPTAC CRC databases. (f) Scatter diagram showing correlations of DKC1 protein expression with CD8+ Tcm cells in CI or CII cluster in 2014 CPTAC CRC databases. (g) Representative images of DKC1 immunochemistry staining and CD8+ T cells in colorectal cancer tissues. (h) Spearman correlation of DKC1 expression with CD8+ T cells in invasive front (where tumor invaded normal lamina propria) in colorectal cancer. (i) The relative DKC1 and CD8 expression of patients in Immunohistochemical high and low score groups (divided by median expression) (* p < 0.05, ** p < 0.01, *** p < 0.001, error bar indicates +/-SEM). (j) Volcano plot showing immunomodulators’ proteomics in CII versus CI in two CRC proteomics databases. Blue indicates Log2 (fold change (CII/CI) > 0.5, p < 0.05) [35]. (k) The boxplot showing the mRNA expressions of immunomodulators in 2014 and 2019 CRC databases. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36428700), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for DKC1 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, Retrieval method: HIER pH6.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: DKC1
Alternate Names
CBF5, CBF5 homolog, cbf5p homolog, DKC, dyskeratosis congenita 1, dyskerin, Dyskerin, EC 5.4.99, EC 5.4.99.-, FLJ97620, H/ACA ribonucleoprotein complex subunit 4, NAP57, NOLA4dyskerin, Nopp140-associated protein of 57 kDa, Nucleolar protein family A member 4, Nucleolar protein NAP57, snoRNP protein DKC1, XAP101
Gene Symbol
DKC1
Additional DKC1 Products
Product Documents for DKC1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for DKC1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for DKC1 Antibody - BSA Free
Customer Reviews for DKC1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review DKC1 Antibody - BSA Free and earn rewards!
Have you used DKC1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...