DKC1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85156

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (99%), Rat (92%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: EAGTYIRTLCVHLGLLLGVGGQMQELRRVRSGVMSEKDHMVTMHDVLDAQWLYDNHKDESYLRRVVYPLEKLLTSHKRLVMKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVIT

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DKC1 Antibody - BSA Free

Western Blot: DKC1 Antibody [NBP1-85156]

Western Blot: DKC1 Antibody [NBP1-85156]

Western Blot: DKC1 Antibody [NBP1-85156] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human cell line A-431 Lane 5: Human liver tissue Lane 6: Human tonsil tissue
Immunohistochemistry-Paraffin: DKC1 Antibody [NBP1-85156]

Immunohistochemistry-Paraffin: DKC1 Antibody [NBP1-85156]

Immunohistochemistry-Paraffin: DKC1 Antibody [NBP1-85156] - Staining of human cerebral cortex shows strong nucleolar positivity in neuronal cells.
DKC1 Antibody - BSA Free

Immunohistochemistry: DKC1 Antibody - BSA Free [NBP1-85156] -

Distinct immune microenvironments exist in CI and CII. (a) Comparisons of Lymphocytes Fraction (see Section 4) between two clusters in two CRC databases by different immune faction analysis, xcell, and ESTIMATE [31,32]. (b) Comparisons of Macrophages between two clusters in 2014 CPTAC CRC databases analyzed by three methods, xcell, CIBERSORT, and immune staining of CRC databases [31,33,34]. (c) Comparisons of Monocytes between two clusters in 2019 CPTAC CRC Label free databases analyzed by xcell. (d) The distribution of patients belonging to two clusters in four different immune subtypes from Thorsson et al., 2018, Immunity [35]. (e) Scatter diagram showing correlations of DKC1 protein expression with CD8+ Tcm cells in total patients in 2014 CPTAC CRC databases. (f) Scatter diagram showing correlations of DKC1 protein expression with CD8+ Tcm cells in CI or CII cluster in 2014 CPTAC CRC databases. (g) Representative images of DKC1 immunochemistry staining and CD8+ T cells in colorectal cancer tissues. (h) Spearman correlation of DKC1 expression with CD8+ T cells in invasive front (where tumor invaded normal lamina propria) in colorectal cancer. (i) The relative DKC1 and CD8 expression of patients in Immunohistochemical high and low score groups (divided by median expression) (* p < 0.05, ** p < 0.01, *** p < 0.001, error bar indicates +/-SEM). (j) Volcano plot showing immunomodulators’ proteomics in CII versus CI in two CRC proteomics databases. Blue indicates Log2 (fold change (CII/CI) > 0.5, p < 0.05) [35]. (k) The boxplot showing the mRNA expressions of immunomodulators in 2014 and 2019 CRC databases. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36428700), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for DKC1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, Retrieval method: HIER pH6.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DKC1

DKC1 is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also include the NOLA1, 2 and 3 proteins. The protein encoded by this gene and the three NOLA proteins localize to the dense fibrillar components of nucleoli and to coiled (Cajal) bodies in the nucleus. Both 18S rRNA production and rRNA pseudouridylation are impaired if any one of the four proteins is depleted. These four H/ACA snoRNP proteins are also components of the telomerase complex. The protein encoded by this gene is related to the Saccharomyces cerevisiae Cbf5p and Drosophila melanogaster Nop60B proteins. The gene lies in a tail-to-tail orientation with the palmitoylated erythrocyte membrane protein gene and is transcribed in a telomere to centromere direction. Both nucleotide substitutions and single trinucleotide repeat polymorphisms have been found in this gene. Mutations in this gene cause X-linked dyskeratosis congenita, a disease resulting in reticulate skin pigmentation, mucosal leukoplakia, nail dystrophy, and progressive bone marrow failure in most cases. Mutations in this gene also cause Hoyeraal-Hreidarsson syndrome, which is a more severe form of dyskeratosis congenita. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

CBF5, CBF5 homolog, cbf5p homolog, DKC, dyskeratosis congenita 1, dyskerin, Dyskerin, EC 5.4.99, EC 5.4.99.-, FLJ97620, H/ACA ribonucleoprotein complex subunit 4, NAP57, NOLA4dyskerin, Nopp140-associated protein of 57 kDa, Nucleolar protein family A member 4, Nucleolar protein NAP57, snoRNP protein DKC1, XAP101

Gene Symbol

DKC1

Additional DKC1 Products

Product Documents for DKC1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DKC1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for DKC1 Antibody - BSA Free

Customer Reviews for DKC1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DKC1 Antibody - BSA Free and earn rewards!

Have you used DKC1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...