DMAP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87276

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all DMAP1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human DMAP1. Peptide sequence: MATGADVRDILELGGPEGDAASGTISKKDIINPDKKKSKKSSETLTFKRP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for DMAP1 Antibody - BSA Free

Western Blot: DMAP1 Antibody [NBP2-87276]

Western Blot: DMAP1 Antibody [NBP2-87276]

Western Blot: DMAP1 Antibody [NBP2-87276] - WB Suggested Anti-DMAP1 Antibody Titration: 2.5ug/ml. ELISA Titer: 1:312500. Positive Control: Jurkat cell lysate
Immunohistochemistry-Paraffin: DMAP1 Antibody [NBP2-87276]

Immunohistochemistry-Paraffin: DMAP1 Antibody [NBP2-87276]

Immunohistochemistry-Paraffin: DMAP1 Antibody [NBP2-87276] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue. Observed Staining: Cytoplasmic. Primary Antibody Concentration: 1:100.

Applications for DMAP1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DMAP1

DMAP1 (DNA methyltransferase 1 associated protein 1) has been identified as a subunit of several distinct protein complexes involved in the repression and activation of transcription. It has been observed to interact with histone deacetylase 2 (HDAC2) as well as histone acetyltransferase (HAT) indicating a role in nucleosome modification to regulate transcription. DMAP1 can act independently to repress transcription in association with DNA methyltransferase 1. Alternate names for DMAP1 include DNMT1-associated protein 1, DNMAP1, DMAP1, KIAA1425, EAF2, SWC4, DNMAP1, DNMTAP1, FLJ11543, and DKFZp686L09142.

Alternate Names

DNA methyltransferase 1 associated protein 1, DNA methyltransferase 1-associated protein 1, DNMAP1DNMT1-associated protein 1, DNMT1 associated protein 1, DNMTAP1, EAF2, FLJ11543, KIAA1425DKFZp686L09142, MEAF2, SWC4

Gene Symbol

DMAP1

Additional DMAP1 Products

Product Documents for DMAP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DMAP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DMAP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DMAP1 Antibody - BSA Free and earn rewards!

Have you used DMAP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies