DMRTA1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84794

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all DMRTA1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DMRTA1. Peptide sequence: AENPQSTGGPAAGAALGLGALRQASGSATPAFEVFQQDYPEEKQEQKESK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for DMRTA1 Antibody - BSA Free

Western Blot: DMRTA1 Antibody [NBP2-84794]

Western Blot: DMRTA1 Antibody [NBP2-84794]

Western Blot: DMRTA1 Antibody [NBP2-84794] - WB Suggested Anti-DMRTA1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: Hela cell lysate

Applications for DMRTA1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DMRTA1

DMRTA1, also known as Doublesex and mab-3-related transcription factor A1, is a 53.1 kDa, 504 amino acid protein that is expressed in the prostate, pancreas, liver, and kidney as a member of the DMRT family. Current research is exploring the involvement of the protein with prostatitis and metabolic acidosis. The protein interacts with STAT5B and ORC5 proteins in transcription pathways.

Alternate Names

DMO, DMRT-like family A1, doublesex- and mab-3-related transcription factor A1, MGC163307, MGC163309

Gene Symbol

DMRTA1

Additional DMRTA1 Products

Product Documents for DMRTA1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DMRTA1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DMRTA1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DMRTA1 Antibody - BSA Free and earn rewards!

Have you used DMRTA1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies