DNA Primase large subunit Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84798

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DNA Primase large subunit. Peptide sequence: QDFLKDSQLQFEAISDEEKTLREQEIVASSPSLSGLKLGFKSIYKPPFAS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for DNA Primase large subunit Antibody - BSA Free

Western Blot: DNA Primase large subunit Antibody [NBP2-84798]

Western Blot: DNA Primase large subunit Antibody [NBP2-84798]

Western Blot: DNA Primase large subunit Antibody [NBP2-84798] - WB Suggested Anti-PRIM2 Antibody Titration: 5.0ug/ml. Positive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that PRIM2 is expressed in HepG2

Applications for DNA Primase large subunit Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DNA Primase large subunit

The replication of DNA in eukaryotic cells is carried out by a complex chromosomal replication apparatus, in which DNA polymerase alpha and primase are two key enzymatic components. Primase, which is a heterodimer of a small subunit and a large subunit, synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication. The protein encoded by this gene is the large, 58 kDa primase subunit. (provided by RefSeq)

Alternate Names

dJ422B11.1.1, DNA primase 58 kDa subunit, DNA primase subunit p58, EC 2.7.7, EC 2.7.7.-, MGC75142, p58, polypeptide 2A, p58, PRIM2ADNA primase large subunit, primase polypeptide 2A, 58kDa, primase, DNA, polypeptide 2 (58kDa), primase, polypeptide 2A (58kD), primase, polypeptide 2A, 58kDa

Gene Symbol

PRIM2

Additional DNA Primase large subunit Products

Product Documents for DNA Primase large subunit Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DNA Primase large subunit Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DNA Primase large subunit Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DNA Primase large subunit Antibody - BSA Free and earn rewards!

Have you used DNA Primase large subunit Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...