DNA Primase small subunit Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58184

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DNA Primase small subunit Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PRIM1(primase, polypeptide 1, 49kDa) The peptide sequence was selected from the N terminal of PRIM1. Peptide sequence SQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQKM. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for DNA Primase small subunit Antibody - BSA Free

Western Blot: DNA Primase small subunit Antibody [NBP1-58184]

Western Blot: DNA Primase small subunit Antibody [NBP1-58184]

Western Blot: DNA Primase small subunit Antibody [NBP1-58184] - Titration: 1.25ug/ml Positive Control: K562 cell lysate.

Applications for DNA Primase small subunit Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DNA Primase small subunit

The replication of DNA in eukaryotic cells is carried out by a complex chromosomal replication apparatus, in which DNA polymerase alpha and primase are two key enzymatic components. Primase, which is a heterodimer of a small subunit and a large subunit, synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication. PRIM1 is the small, 49 kDa primase subunit.The replication of DNA in eukaryotic cells is carried out by a complex chromosomal replication apparatus, in which DNA polymerase alpha and primase are two key enzymatic components. Primase, which is a heterodimer of a small subunit and a large subunit, synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication. The protein encoded by this gene is the small, 49 kDa primase subunit.

Alternate Names

DNA primase 1, DNA primase 49 kDa subunit, DNA primase small subunit, DNA primase subunit 48, EC 2.7.7, EC 2.7.7.-, MGC12308, p49, primase p49 subunit, primase polypeptide 1, 49kDa, primase, DNA, polypeptide 1 (49kDa)

Gene Symbol

PRIM1

UniProt

P49642 (Human)

Additional DNA Primase small subunit Products

Product Documents for DNA Primase small subunit Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DNA Primase small subunit Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DNA Primase small subunit Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DNA Primase small subunit Antibody - BSA Free and earn rewards!

Have you used DNA Primase small subunit Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies