DNAJB13 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-68770

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DNAJB13 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: WTTGYVFHGKPEKVFHEFFGGNNPFSEFFDAEGSEVDLNFGGLQGRGVKKQDPQVERDLYLSLE

Reactivity Notes

Mouse 84%, Rat 86%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DNAJB13 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: DNAJB13 Antibody [NBP2-68770]

Immunocytochemistry/ Immunofluorescence: DNAJB13 Antibody [NBP2-68770]

Immunocytochemistry/Immunofluorescence: DNAJB13 Antibody [NBP2-68770] - Staining of human cell line PC-3 shows localization to plasma membrane.

Applications for DNAJB13 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DNAJB13

DNAJB13, also known as DnaJ homolog subfamily B member 13, consists of a 36.1 kDa and a 16.1 kDa isoform and is involved in regulating molecular activity as a member of the DNAJ/HSP40 family as well as inhibiting apoptosis during testis spermatogenesis. Current research is being conducted on diseases and disorders such as pneumonia, malaria, mycobacterium tuberculosis, and cryptorchidism. The protein interacts with STIP1. No known pathways are listed.

Alternate Names

DnaJ (Hsp40) homolog, subfamily B, member 13,1700014P03Rik, DnaJ (Hsp40) related, subfamily B, member 13, dnaJ homolog subfamily B member 13, DnaJ-like protein, radial spoke 16 homolog A, RSPH16A, Testis and spermatogenesis cell-related protein 6, Testis spermatocyte apoptosis-related gene 6 protein, Testis spermatogenesis apoptosis-related gene 3 protein, Testis spermatogenesis apoptosis-related gene 6 protein, testis spermatogenesis apoptosis-related protein 6, TSARG3, TSARG5, TSARG6FLJ46748

Gene Symbol

DNAJB13

Additional DNAJB13 Products

Product Documents for DNAJB13 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DNAJB13 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DNAJB13 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DNAJB13 Antibody - BSA Free and earn rewards!

Have you used DNAJB13 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies