DNAJB6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54951

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to DNAJB6(DnaJ (Hsp40) homolog, subfamily B, member 6) The peptide sequence was selected from the N terminal of DNAJB6. Peptide sequence PENKEEAERKFKQVAEAYEVLSDAKKRDIYDKYGKEGLNGGGGGGSHFDS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for DNAJB6 Antibody - BSA Free

Western Blot: DNAJB6 Antibody [NBP1-54951]

Western Blot: DNAJB6 Antibody [NBP1-54951]

Western Blot: DNAJB6 Antibody [NBP1-54951] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Applications for DNAJB6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DNAJB6

DNAJB6 is a member of the DNAJ protein family. DNAJ family members are characterized by a highly conserved amino acid stretch called the 'J-domain' and function as one of the two major classes of molecular chaperones involved in a wide range of cellular events, such as protein folding and oligomeric protein complex assembly. This family member may also play a role in polyglutamine aggregation in specific neurons.This gene encodes a member of the DNAJ protein family. DNAJ family members are characterized by a highly conserved amino acid stretch called the 'J-domain' and function as one of the two major classes of molecular chaperones involved in a wide range of cellular events, such as protein folding and oligomeric protein complex assembly. This family member may also play a role in polyglutamine aggregation in specific neurons. Alternative splicing of this gene results in multiple transcript variants; however, not all variants have been fully described.

Alternate Names

DJ4, DKFZp566D0824, DnaJ, DnaJ (Hsp40) homolog, subfamily B, member 6, dnaJ homolog subfamily B member 6, DnaJ-like 2 protein, FLJ42837, Heat shock protein J2, HHDJ1, HSJ2, HSJ-2, MGC1152, MRJMGC117297, MSJ1, MSJ-1

Gene Symbol

DNAJB6

UniProt

Additional DNAJB6 Products

Product Documents for DNAJB6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DNAJB6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DNAJB6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DNAJB6 Antibody - BSA Free and earn rewards!

Have you used DNAJB6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...