DNCIC1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38933

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (98%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DNCIC1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: LQSDSELGRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSEEDEEDEE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DNCIC1 Antibody - BSA Free

Immunohistochemistry-Paraffin: DNCIC1 Antibody [NBP2-38933]

Immunohistochemistry-Paraffin: DNCIC1 Antibody [NBP2-38933]

Immunohistochemistry-Paraffin: DNCIC1 Antibody [NBP2-38933] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: DNCIC1 Antibody [NBP2-38933]

Immunohistochemistry-Paraffin: DNCIC1 Antibody [NBP2-38933]

Immunohistochemistry-Paraffin: DNCIC1 Antibody [NBP2-38933] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells, cells in molecular layer and cells in granular layer.
Immunohistochemistry-Paraffin: DNCIC1 Antibody [NBP2-38933]

Immunohistochemistry-Paraffin: DNCIC1 Antibody [NBP2-38933]

Immunohistochemistry-Paraffin: DNCIC1 Antibody [NBP2-38933] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: DNCIC1 Antibody [NBP2-38933]

Immunohistochemistry-Paraffin: DNCIC1 Antibody [NBP2-38933]

Immunohistochemistry-Paraffin: DNCIC1 Antibody [NBP2-38933] - Staining in human cerebral cortex and lymph node tissues using anti-DYNC1I1 antibody. Corresponding DYNC1I1 RNA-seq data are presented for the same tissues.

Applications for DNCIC1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DNCIC1

Eukaryotic cells rely on actin and microtubule-based protein "motors" to generate intracellular movements.4 These protein "motors" contain specialized domains that hydrolyse ATP to produce force and movement along a cytoskeletal polymer (actin in the case of myosin family and microtubules in the case of the kinesin family and dyneins). The minus-end-directed, microtubule motor, dynein ATPase is one of the most widely studied microtubule-associated energy transducing enzymes. It constitutes the outer and inner arms on the doublet tubules of sperm flagellar axonemes, where it generates the sliding between doublets that underlies flagellar beating. Dynein has also been implicated in cytoplasmic motile functions, including chromosomal movement, retrograde organelle and axonal transport, the endocytic pathway, and the organization of the Golgi apparatus. In all cell types, dynein has the same basic structures and is composed of two or three distinct heavy chains (approximately 450 kDa), three intermediate chains (70-125 kDa), and at least four light chains (15-25 kDa).5

Alternate Names

cytoplasmic dynein 1 intermediate chain 1, Cytoplasmic dynein intermediate chain 1, DNCI1cytoplasmic, intermediate polypeptide 1, DNCIC1DH IC-1, Dynein intermediate chain 1, cytosolic, dynein, cytoplasmic 1, intermediate chain 1

Gene Symbol

DYNC1I1

UniProt

O14576 (Human)

Additional DNCIC1 Products

Product Documents for DNCIC1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DNCIC1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DNCIC1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DNCIC1 Antibody - BSA Free and earn rewards!

Have you used DNCIC1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies