DOK2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-62652

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: RPDHIYDEPEGVAALSLYDSPQEPRGEAWRRQATADRDPAGLQHVQPAGQDFSASGWQPGTEYDNVVLKKGPK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DOK2 Antibody - BSA Free

Immunohistochemistry-Paraffin: DOK2 Antibody [NBP2-62652]

Immunohistochemistry-Paraffin: DOK2 Antibody [NBP2-62652]

Immunohistochemistry-Paraffin: DOK2 Antibody [NBP2-62652] - Staining of human lymph node shows high expression.
Immunohistochemistry-Paraffin: DOK2 Antibody [NBP2-62652]

Immunohistochemistry-Paraffin: DOK2 Antibody [NBP2-62652]

Immunohistochemistry-Paraffin: DOK2 Antibody [NBP2-62652] - Analysis in human lymph node and skeletal muscle tissues using Anti-DOK2 antibody. Corresponding DOK2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: DOK2 Antibody [NBP2-62652]

Immunohistochemistry-Paraffin: DOK2 Antibody [NBP2-62652]

Immunohistochemistry-Paraffin: DOK2 Antibody [NBP2-62652] - Staining of human skeletal muscle shows low expression as expected.

Applications for DOK2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DOK2

Docking proteins interact with receptor tyrosine kinases and mediate particular biological responses using signal transduction. DOK2 acts as a multiple docking protein downstream of receptor or non-receptor tyrosine kinases. By this mechanism it acts to negatively regulate signal transduction and cell proliferation controlled by cytokines in a feedback loop. DOK2 is highly expressed in cells and tissues of hematopoietic origin as well as in lung. Expression of bcr/abl induces additional tyrosine phosphorylation of the DOK1 and DOK2 proteins and their association with Ras-GAP. Thus, it is suspected that DOK association regulates GAP activity toward Ras and that the DOK proteins serve as mediators of bcr-abl signaling. The role of DOK proteins in bcr-abl regulation may also be implicated in chronic myelogenous leukemia (CML), which is characterized by a Philadelphia chromosome translocation t(9;22). Such a mutation would result in a p210-bcr/abl chimeric protein-tyrosine kinase which has been found in many CML cases.

Alternate Names

docking protein 2, docking protein 2, 56kD, docking protein 2, 56kDa, Dok-2, Downstream of tyrosine kinase 2, p56(dok-2), P56DOK, p56dok-2

Gene Symbol

DOK2

Additional DOK2 Products

Product Documents for DOK2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DOK2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DOK2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DOK2 Antibody - BSA Free and earn rewards!

Have you used DOK2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...