DONSON Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-70752

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DONSON Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to DONSON(downstream neighbor of SON) The peptide sequence was selected from the middle region of DONSON. Peptide sequence DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for DONSON Antibody - BSA Free

Western Blot: DONSON Antibody [NBP1-70752]

Western Blot: DONSON Antibody [NBP1-70752]

Western Blot: DONSON Antibody [NBP1-70752] - Middle region validated by WB using Mouse brains at 1:1000.
Western Blot: DONSON Antibody [NBP1-70752]

Western Blot: DONSON Antibody [NBP1-70752]

Western Blot: DONSON Antibody [NBP1-70752] - Human LCL and mouse brains incubated for 5 minutes in CDP-Star for 5 minutes, Antibody Titration: 0.2-1 ug/ml

Applications for DONSON Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DONSON

This gene lies downstream of the SON gene and spans 10 kb on chromosome 21. The function of this gene is unknown.This gene lies downstream of the SON gene and spans 10 kb on chromosome 21. The function of this gene is unknown.

Alternate Names

B17, downstream neighbor of SON, protein downstream neighbor of Son

Gene Symbol

DONSON

Additional DONSON Products

Product Documents for DONSON Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DONSON Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DONSON Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DONSON Antibody - BSA Free and earn rewards!

Have you used DONSON Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies