Dopamine D5R/DRD5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10782

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human Dopamine D5R/DRD5 (NP_000789.1). Peptide sequence IVFHKEIAAAYIHMMPNAVTPGNREVDNDEEEGPFDRMFQIYQTSPDGDP

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Dopamine D5R/DRD5 Antibody - BSA Free

Western Blot: Dopamine D5R/DRD5 Antibody [NBP3-10782]

Western Blot: Dopamine D5R/DRD5 Antibody [NBP3-10782]

Western Blot: Dopamine D5R/DRD5 Antibody [NBP3-10782] - Western blot analysis of Dopamine D5R/DRD5 in Human 293T Whole Cell. Antibody dilution at 1.0ug/ml

Applications for Dopamine D5R/DRD5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Dopamine D5R/DRD5

The members of the G protein-coupled receptor family are distinguished by their slow transmitting response to ligand binding. These seven transmembrane proteins include the adrenergic, serotonin, and dopamine receptors. The effect of the signaling molecule can be excitatory or inhibitory depending on the type of receptor to which it binds. Beta-adrenergic receptor bound to adrenaline activates adenylyl cyclase, while alpha 2-adrenergic receptor bound to adrenaline inhibits adenylyl cyclase. The dopamine receptors are divided into two classes; D1 and D2, which differ in their functional characteristics. D1 receptors stimulate adenylyl cyclase, while D2 receptors inhibit adenylyl cyclase activity. Five different subtypes of dopamine receptor have been described to date. D1DR and D5DR belong to the D1 subclass, while D2DR, D3DR and D4DR belong to the D2 subclass of dopamine receptors.

Long Name

Dopamine D5 Receptor

Alternate Names

DBDR, Dopamine D5 R, DRD1B, DRD1L2, DRD5

Gene Symbol

DRD5

Additional Dopamine D5R/DRD5 Products

Product Documents for Dopamine D5R/DRD5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Dopamine D5R/DRD5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Dopamine D5R/DRD5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Dopamine D5R/DRD5 Antibody - BSA Free and earn rewards!

Have you used Dopamine D5R/DRD5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...