DORFIN Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59367

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DORFIN Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to RNF19A(ring finger protein 19A) The peptide sequence was selected from the N terminal of RNF19A. Peptide sequence IFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVD. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for DORFIN Antibody - BSA Free

Western Blot: DORFIN Antibody [NBP1-59367]

Western Blot: DORFIN Antibody [NBP1-59367]

Western Blot: DORFIN Antibody [NBP1-59367] - Titration: 0.2-1 ug/ml, Positive Control: Human brain.

Applications for DORFIN Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DORFIN

RNF19A contains two RING-finger motifs and an IBR (in between RING fingers) motif. This protein is an E3 ubiquintin ligase that is localized in Lewy bodies (LBs), a characteristic neuronal inclusion in Parkinson's disease (PD) brains. This protein interacts with UBE2L3/UBCH7 and UBE2E2/UBCH8, but not other ubiquitin-conjugating enzymes. This protein is found to bind and ubiquitylate synphilin 1 (SNCAIP), which is a interacting protein of alpha synuclein in neurons, and a major component of LB.The protein encoded this gene contains two RING-finger motifs and an IBR (in between RING fingers) motif. This protein is an E3 ubiquintin ligase that is localized in Lewy bodies (LBs), a characteristic neuronal inclusion in Parkinson's disease (PD) brains. This protein interacts with UBE2L3/UBCH7 and UBE2E2/UBCH8, but not other ubiquitin-conjugating enzymes. This protein is found to bind and ubiquitylate synphilin 1 (SNCAIP), which is a interacting protein of alpha synuclein in neurons, and a major component of LB. Alternatively spliced transcript variants encoding the same protein have been reported.

Alternate Names

DKFZp566B1346, DORFIN, Double ring-finger protein, E3 ubiquitin-protein ligase RNF19A, EC 6.3.2, EC 6.3.2.-, p38, protein p38 interacting with transcription factor Sp1, ring finger protein 19, RING finger protein 19 isoform, ring finger protein 19Ap38 protein, ring-IBR-ring domain containing protein Dorfin, RNF19

Gene Symbol

RNF19A

UniProt

Q9NV58 (Human)

Additional DORFIN Products

Product Documents for DORFIN Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DORFIN Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DORFIN Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DORFIN Antibody - BSA Free and earn rewards!

Have you used DORFIN Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies