DPF2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58389

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (97%), Rat (100%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DPF2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AEEEGEDKEDSQPPTPVSQRSEEQKSKKGPDGLALPNNY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DPF2 Antibody - BSA Free

Western Blot: DPF2 Antibody [NBP2-58389]

Western Blot: DPF2 Antibody [NBP2-58389]

Western Blot: DPF2 Antibody [NBP2-58389] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: DPF2 Antibody [NBP2-58389]

Immunocytochemistry/ Immunofluorescence: DPF2 Antibody [NBP2-58389]

Immunocytochemistry/Immunofluorescence: DPF2 Antibody [NBP2-58389] - Staining of human cell line A-431 shows localization to nucleoplasm.
DPF2 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: DPF2 Antibody - BSA Free [NBP2-58389]

Chromatin Immunoprecipitation-exo-Seq: DPF2 Antibody - BSA Free [NBP2-58389]

ChIP-Exo-Seq composite graph for Anti-DPF2 (NBP2-58389) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for DPF2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DPF2

DPF2 is encoded by this gene is a member of the d4 domain family, characterized by a zinc finger-like structural motif. This protein functions as a transcription factor which is necessary for the apoptotic response following deprivation of survival factors. It likely serves a regulatory role in rapid hematopoietic cell growth and turnover. This gene is considered a candidate gene for multiple endocrine neoplasia type I, an inherited cancer syndrome involving multiple parathyroid, enteropancreatic, and pituitary tumors.

Alternate Names

Apoptosis response zinc finger protein, D4, zinc and double PHD fingers family 2BAF45D, MGC10180, Protein requiem, REQBRG1-associated factor 45D, requiem, apoptosis response zinc finger, ubi-d4, UBID4requiem, apoptosis response zinc finger gene, zinc finger protein ubi-d4

Gene Symbol

DPF2

Additional DPF2 Products

Product Documents for DPF2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DPF2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DPF2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DPF2 Antibody - BSA Free and earn rewards!

Have you used DPF2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies