DPF3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87299

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of DPF3. Peptide sequence: IHNPLKALGDQFYKEAIEHCRSYNSRLCAERSVRLPFLDSQTGVAQNNCY The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for DPF3 Antibody - BSA Free

Western Blot: DPF3 Antibody [NBP2-87299]

Western Blot: DPF3 Antibody [NBP2-87299]

Western Blot: DPF3 Antibody [NBP2-87299] - Titration: 1.0 ug/ml. Positive Control: Mouse Spleen
Immunohistochemistry-Paraffin: DPF3 Antibody [NBP2-87299]

Immunohistochemistry-Paraffin: DPF3 Antibody [NBP2-87299]

Immunohistochemistry-Paraffin: DPF3 Antibody [NBP2-87299] - Formalin Fixed Paraffin Embedded Tissue: Human Adult heart. Observed Staining: Nuclear (not in cardiomyocytes but in fibrocytes in endomysium. Primary Antibody Concentration: 1:600.

Applications for DPF3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DPF3

Muscle-specific component of the BAF complex, a multiprotein complex involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Specifically binds acetylated lysines on histone 3 and 4 (H3K14ac, H3K9ac, H4K5ac, H4K8ac, H4K12ac, H4K16ac). In the complex, it acts as a tissue-specific anchor between histone acetylations and methylations and chromatin remodeling. It thereby probably plays an essential role in heart and skeletal muscle development

Alternate Names

CERD4, D4, zinc and double PHD fingers, family 3

Gene Symbol

DPF3

Additional DPF3 Products

Product Documents for DPF3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DPF3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DPF3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DPF3 Antibody - BSA Free and earn rewards!

Have you used DPF3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...