DPP6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-47481

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: VKKAINDRQMPKVEYRDIEIDDYNLPMQILKPATFTDTTHYPLLLVVDGTPGSQSVAEKFEVSWETVMVSSHGAVVVKCDG

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (86%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DPP6 Antibody - BSA Free

Western Blot: DPP6 Antibody [NBP2-47481]

Western Blot: DPP6 Antibody [NBP2-47481]

Western Blot: DPP6 Antibody [NBP2-47481] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human Cerebral Cortex tissue
Immunohistochemistry: DPP6 Antibody [NBP2-47481]

Immunohistochemistry: DPP6 Antibody [NBP2-47481]

Immunohistochemistry: DPP6 Antibody [NBP2-47481] - Staining mouse ventral tegmental area shows immunoreactivity in neuronal cell bodies.
Immunohistochemistry-Paraffin: DPP6 Antibody [NBP2-47481]

Immunohistochemistry-Paraffin: DPP6 Antibody [NBP2-47481]

Immunohistochemistry-Paraffin: DPP6 Antibody [NBP2-47481] - Staining of human cerebral cortex shows distinct positivity in neuropil.
Immunohistochemistry-Paraffin: DPP6 Antibody [NBP2-47481]

Immunohistochemistry-Paraffin: DPP6 Antibody [NBP2-47481]

Immunohistochemistry-Paraffin: DPP6 Antibody [NBP2-47481] - Staining of hippocampus tissue. Shows positivity in neuropil.
Immunohistochemistry-Paraffin: DPP6 Antibody [NBP2-47481]

Immunohistochemistry-Paraffin: DPP6 Antibody [NBP2-47481]

Immunohistochemistry-Paraffin: DPP6 Antibody [NBP2-47481] - Staining of human Analysis of hippocampus tissue. Shows strong immunoreactivity in neuropil.
Immunohistochemistry: DPP6 Antibody [NBP2-47481]

Immunohistochemistry: DPP6 Antibody [NBP2-47481]

Immunohistochemistry: DPP6 Antibody [NBP2-47481] - Staining mouse cerebellum shows positivity in Purkinje cells.
Immunohistochemistry: DPP6 Antibody [NBP2-47481]

Immunohistochemistry: DPP6 Antibody [NBP2-47481]

Immunohistochemistry: DPP6 Antibody [NBP2-47481] - Staining hippocampus tissue. Shows immunoreactivity in the CA3 layer.
Immunohistochemistry: DPP6 Antibody [NBP2-47481]

Immunohistochemistry: DPP6 Antibody [NBP2-47481]

Immunohistochemistry: DPP6 Antibody [NBP2-47481] - Staining mouse olfactory bulb shows immunoreactivity processes in the external plexiform layer.
Immunohistochemistry: DPP6 Antibody [NBP2-47481]

Immunohistochemistry: DPP6 Antibody [NBP2-47481]

Immunohistochemistry: DPP6 Antibody [NBP2-47481] - Staining mouse somatosensory cortex shows selective labeling in a subset of neurons.

Applications for DPP6 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DPP6

The Anthrax toxin receptor (ATR) was initially discovered as the tumor endothelial marker 8 (TEM8). This protein, which exists in three isoforms (36, 40, and 60 kDa), is highly expressed in tumor vessels as well as in the vasculature of developing embryos, suggesting that it may normally play a role in angiogenesis. However, it also acts as the receptor for anthrax toxin. Following the binding of this protein by the protective antigen (PA) of anthrax, PA is cleaved and heptamerizes to form the binding site for both edema factor (EF) and lethal factor (LF). This complex is then endocytosed by the cell; acidification in endosomes allows the release of EF and LF into the cytoplasm where they interfere with MAPK signaling and induce apoptosis.

Long Name

Dipeptidyl-peptidase 6

Alternate Names

DPPX

Gene Symbol

DPP6

Additional DPP6 Products

Product Documents for DPP6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DPP6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for DPP6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DPP6 Antibody - BSA Free and earn rewards!

Have you used DPP6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...