DPS Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54645

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DPS Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PDSS1(prenyl (decaprenyl) diphosphate synthase, subunit 1) The peptide sequence was selected from the middle region of PDSS1. Peptide sequence GEFLQLGSKENENERFAHYLEKTFKKTASLIANSCKAVSVLGCPDPVVHE. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: 1.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for DPS Antibody - BSA Free

Western Blot: DPS Antibody [NBP1-54645]

Western Blot: DPS Antibody [NBP1-54645]

Western Blot: DPS Antibody [NBP1-54645] - HepG2 cell lysate, concentration 5.0ug/ml.

Applications for DPS Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DPS

PDSS1 is an enzyme that elongates the prenyl side-chain of coenzyme Q, or ubiquinone, one of the key elements in the respiratory chain. PDSS1 catalyzes the formation of all trans-polyprenyl pyrophosphates from isopentyl diphosphate in the assembly of polyisoprenoid side chains, the first step in coenzyme Q biosynthesis. The protein may be peripherally associated with the inner mitochondrial membrane, though no transit peptide has been definitively identified to date. Defects in PDSS1 gene are a cause of coenzyme Q10 deficiency.The protein encoded by this gene is an enzyme that elongates the prenyl side-chain of coenzyme Q, or ubiquinone, one of the key elements in the respiratory chain. The gene product catalyzes the formation of all trans-polyprenyl pyrophosphates from isopentyl diphosphate in the assembly of polyisoprenoid side chains, the first step in coenzyme Q biosynthesis. The protein may be peripherally associated with the inner mitochondrial membrane, though no transit peptide has been definitively identified to date. Defects in this gene are a cause of coenzyme Q10 deficiency.

Alternate Names

All-trans-decaprenyl-diphosphate synthase subunit 1, COQ1SPS, Decaprenyl pyrophosphate synthase subunit 1, decaprenyl-diphosphate synthase subunit 1, DPS, DPS1, EC 2.5.1.91, hDPS1, MGC70953, polyprenyl pyrophosphate synthetase, prenyl (decaprenyl) diphosphate synthase, subunit 1, RP13-16H11.3, subunit 1 of decaprenyl diphosphate synthase, TPRT, TPT 1, TPTcoenzyme Q1 homolog, trans-prenyltransferase, trans-prenyltransferase (TPT), Trans-prenyltransferase 1

Gene Symbol

PDSS1

UniProt

Q5T2R2 (Human)

Additional DPS Products

Product Documents for DPS Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DPS Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DPS Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DPS Antibody - BSA Free and earn rewards!

Have you used DPS Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies