Drosha Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57139

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Drosha Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to RNASEN(ribonuclease type III, nuclear) The peptide sequence was selected from the middle region of RNASEN. Peptide sequence AAMDALEKYNFPQMAHQKRFIERKYRQELKEMRWEREHQEREPDETEDIK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Drosha Antibody - BSA Free

Western Blot: Drosha Antibody [NBP1-57139]

Western Blot: Drosha Antibody [NBP1-57139]

Western Blot: Drosha Antibody [NBP1-57139] - Human Spleen lysate, concentration 0.2-1 ug/ml.

Applications for Drosha Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Drosha

RNASEN is a ribonuclease III double-stranded (ds) RNA-specific endoribonuclease that is involved in the initial step of microRNA (miRNA) biogenesis. Component of the microprocessor complex that is required to process primary miRNA transcripts (pri-miRNAs) to release precursor miRNA (pre-miRNA) in the nucleus. Within the microprocessor complex, RNASEN/DROSHA cleaves the 3' and 5' strands of a stem-loop in pri-miRNAs (processing center 11 bp from the dsRNA-ssRNA junction) to release hairpin-shaped pre-miRNAs that are subsequently cut by the cytoplasmic DICER to generate mature miRNAs. RNASEN is also involved in pre-rRNA processing. RNASEN cleaves double-strand RNA and does not cleave single-strand RNA. RNASEN is involved in the formation of GW bodies.Members of the ribonuclease III superfamily of double-stranded (ds) RNA-specific endoribonucleases participate in diverse RNA maturation and decay pathways in eukaryotic and prokaryotic cells (Fortin et al., 2002 [PubMed 12191433]). The RNase III Drosha is the core nuclease that executes the initiation step of microRNA (miRNA) processing in the nucleus (Lee et al., 2003 [PubMed 14508493]).[supplied by OMIM].

Alternate Names

drosha, double-stranded RNA-specific endoribonuclease, drosha, ribonuclease type III, EC 3.1.26.3, ETOHI2, nuclear RNase III Drosha, p241, Protein Drosha, putative protein p241 which interacts with transcription factor Sp1, putative ribonuclease III, RANSE3L, ribonuclease 3, Ribonuclease III, ribonuclease III, nuclear, RN3nuclear, RNase III

Gene Symbol

DROSHA

UniProt

Q9NRR4 (Human)

Additional Drosha Products

Product Documents for Drosha Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Drosha Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Drosha Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Drosha Antibody - BSA Free and earn rewards!

Have you used Drosha Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies