DSCR3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82928

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all DSCR3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DSCR3. Peptide sequence: SAPQKGKFTPSPVDFTITPETLQNVKERALLPKFLLRGHLNSTNCVITQP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for DSCR3 Antibody - BSA Free

Western Blot: DSCR3 Antibody [NBP2-82928]

Western Blot: DSCR3 Antibody [NBP2-82928]

Western Blot: DSCR3 Antibody [NBP2-82928] - Host: Rabbit. Target Name: DSCR3. Sample Tissue: Human 721_B Whole Cell. Antibody Dilution: 1ug/ml

Applications for DSCR3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DSCR3

The region of chromosome 21 between genes CBR and ERG (CBR-ERG region), which spans 2.5 Mb on 21q22.2, has been defined by analysis of patients with partial trisomy 21. It contributes significantly to the pathogenesis of many characteristics of Down syndrome, including morphological features, hypotonia, and mental retardation. The DSCR3 (Down syndrome critical region gene 3) gene is found in this region and is predictated to contain eight exons. DSCR3 is expressed in most tissues examined. [provided by RefSeq].

Alternate Names

DCRA10Down syndrome critical region protein 3, Down syndrome critical region gene 3, DSCRA, MGC117385

Gene Symbol

DSCR3

Additional DSCR3 Products

Product Documents for DSCR3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DSCR3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DSCR3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DSCR3 Antibody - BSA Free and earn rewards!

Have you used DSCR3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies