DTX1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58472

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DTX1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PPVSKSDVKPVPGVPGVCRKTKKKHLKKSKNPEDVVRRYMQKVKNPP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit DTX1 Antibody - BSA Free (NBP2-58472) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for DTX1 Antibody - BSA Free

Immunohistochemistry-Paraffin: DTX1 Antibody [NBP2-58472]

Immunohistochemistry-Paraffin: DTX1 Antibody [NBP2-58472]

Immunohistochemistry-Paraffin: DTX1 Antibody [NBP2-58472] - Staining of human Lymph node shows moderate cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: DTX1 Antibody [NBP2-58472]

Immunohistochemistry-Paraffin: DTX1 Antibody [NBP2-58472]

Immunohistochemistry-Paraffin: DTX1 Antibody [NBP2-58472] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: DTX1 Antibody [NBP2-58472]

Immunohistochemistry-Paraffin: DTX1 Antibody [NBP2-58472]

Immunohistochemistry-Paraffin: DTX1 Antibody [NBP2-58472] - Analysis in human lymph node and placenta tissues using NBP2-58472 antibody. Corresponding DTX1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: DTX1 Antibody [NBP2-58472]

Immunohistochemistry-Paraffin: DTX1 Antibody [NBP2-58472]

Immunohistochemistry-Paraffin: DTX1 Antibody [NBP2-58472] - Staining of human Cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: DTX1 Antibody [NBP2-58472]

Immunohistochemistry-Paraffin: DTX1 Antibody [NBP2-58472]

Immunohistochemistry-Paraffin: DTX1 Antibody [NBP2-58472] - Staining of human Cerebral cortex shows moderate nuclear and cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: DTX1 Antibody [NBP2-58472]

Immunohistochemistry-Paraffin: DTX1 Antibody [NBP2-58472]

Immunohistochemistry-Paraffin: DTX1 Antibody [NBP2-58472] - Staining of human Placenta shows no positivity in trophoblastic cells as expected.

Applications for DTX1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DTX1

DTX1, also known as E3 ubiquitin-protein ligase DTX1, is a 67.4 kDa, 620 amino acid protein that is involved in regulating the Notch pathway by monitoring ubiquitination and stimulating the breakdown of MEKK1. Current research is being conducted with diseases and disorders such as osteosarcoma, Noonan syndrome, and neuronitis. The protein interacts in disease and Notch signaling pathways with CRK, ITCH, UBE2D2, UBE2D3, and UBC.

Long Name

Deltex 1

Alternate Names

Deltex1, Dx-1

Gene Symbol

DTX1

Additional DTX1 Products

Product Documents for DTX1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DTX1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Notch Pathway

Customer Reviews for DTX1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DTX1 Antibody - BSA Free and earn rewards!

Have you used DTX1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies