DTX4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-32448

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: DSTGTIRGPLKTAPSQVIRRQASSMPTGTTMGSPASPPGPNSKTGRVALATLNRTNLQRLAIAQSRVLIASGVPTVPVKNLNGSSP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DTX4 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: DTX4 Antibody [NBP2-32448]

Immunocytochemistry/ Immunofluorescence: DTX4 Antibody [NBP2-32448]

Immunocytochemistry/Immunofluorescence: DTX4 Antibody [NBP2-32448] - Staining of mouse pons shows strong cytoplasmic positivity in neurons of the motor trigeminal nucleus.
Immunohistochemistry-Paraffin: DTX4 Antibody [NBP2-32448]

Immunohistochemistry-Paraffin: DTX4 Antibody [NBP2-32448]

Immunohistochemistry-Paraffin: DTX4 Antibody [NBP2-32448] - Staining of human hippocampus shows moderate granular immunoreactivity in neuronal cell bodies.
Immunocytochemistry/ Immunofluorescence: DTX4 Antibody [NBP2-32448]

Immunocytochemistry/ Immunofluorescence: DTX4 Antibody [NBP2-32448]

Immunocytochemistry/Immunofluorescence: DTX4 Antibody [NBP2-32448] - Staining of mouse hippocampus shows restricted positivity in the CA2/CA3 areas.
Immunocytochemistry/ Immunofluorescence: DTX4 Antibody [NBP2-32448]

Immunocytochemistry/ Immunofluorescence: DTX4 Antibody [NBP2-32448]

Immunocytochemistry/Immunofluorescence: DTX4 Antibody [NBP2-32448] - Staining of mouse olfactory bulb shows weak staining in the external plexiform layer.
Immunocytochemistry/ Immunofluorescence: DTX4 Antibody [NBP2-32448]

Immunocytochemistry/ Immunofluorescence: DTX4 Antibody [NBP2-32448]

Immunocytochemistry/Immunofluorescence: DTX4 Antibody [NBP2-32448] - Staining of mouse pons shows cytoplasmic staining in the vestibular nucleus.
Immunocytochemistry/ Immunofluorescence: DTX4 Antibody [NBP2-32448]

Immunocytochemistry/ Immunofluorescence: DTX4 Antibody [NBP2-32448]

Immunocytochemistry/Immunofluorescence: DTX4 Antibody [NBP2-32448] - Immunofluorescent staining of human cell line CACO-2 shows localization to vesicles.
Immunohistochemistry: DTX4 Antibody [NBP2-32448]

Immunohistochemistry: DTX4 Antibody [NBP2-32448]

Immunohistochemistry: DTX4 Antibody [NBP2-32448] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: DTX4 Antibody [NBP2-32448]

Immunohistochemistry-Paraffin: DTX4 Antibody [NBP2-32448]

Immunohistochemistry-Paraffin: DTX4 Antibody [NBP2-32448] - Staining of human cerebellum shows strong granular cytoplasmic immunoreactivity in Purkinje cells.

Applications for DTX4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DTX4

Long Name

Deltex 4

Alternate Names

Deltex 4 Homolog, Deltex 4 Homolog (Drosophila), Deltex Homolog 4 (Drosophila), deltex4, E3 Ubiquitin-Protein Ligase DTX4, EC 6.3.2., KIAA0937, Protein Deltex-4, RING Finger Protein 155, RNF155

Gene Symbol

DTX4

Additional DTX4 Products

Product Documents for DTX4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DTX4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for DTX4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DTX4 Antibody - BSA Free and earn rewards!

Have you used DTX4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...