DUSP4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-24803

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein DUSP4 using the following amino acid sequence: QVLATSCAAEAASPSGPLRERGKTPATPTSQFVFSFPVSVGVHSAPSSLPYLHS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DUSP4 Antibody - BSA Free

DUSP4 Antibody Western Blot: DUSP4 Antibody [NBP3-24803]

Western Blot: DUSP4 Antibody [NBP3-24803]

Lane 1: Marker [kDa] 250,130,95,72,55,36,28,17,10
Lane 2: RT-4
Lane 3: U-251MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
DUSP4 Antibody Immunocytochemistry/Immunofluorescence: DUSP4 Antibody [NBP3-24803]

Immunocytochemistry/Immunofluorescence: DUSP4 Antibody [NBP3-24803]

Staining of human cell line SK-MEL-30 shows localization to nucleoplasm.

Applications for DUSP4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 µg/ml

Western Blot

0.04-0.4 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DUSP4

Mitogen-activated protein (MAP) kinases are a large class of proteins involved in signal transduction pathways that are activated by a range of stimuli and mediate a number of physiological and pathological changes in the cell. Dual specificity phosphatases (DSPs) are a subclass of the protein tyrosine phosphatase (PTP) gene superfamily, which are selective for dephosphorylating critical phosphothreonine and phosphotyrosine residues within MAP kinases. DSP gene expression is induced by a host of growth factors and/or cellular stresses, thereby negatively regulating MAP kinase superfamily members including MAPK/ERK, SAPK/JNK and p38. The members of the dual-specificity phosphatase protein family include MKP-1/CL100 (3CH134), VHR, PAC1, MKP-2, hVH-3 (B23), hVH-5, MKP-3, MKP-X, and MKP- 4. Human MKP-2 maps to chromosome 8p12-p11 and encodes a 394 amino acid, 43 kDa protein that specifically inactivates ERK1, ERK2 and JNK.

Alternate Names

dual specificity phosphatase 4, Dual specificity protein phosphatase hVH2, EC 3.1.3.16, EC 3.1.3.48, HVH2serine/threonine specific protein phosphatase, MAP kinase phosphatase 2, Mitogen-activated protein kinase phosphatase 2, MKP-2dual specificity protein phosphatase 4, MKP2VH1 homologous phosphatase 2, TYP, VH2

Gene Symbol

DUSP4

Additional DUSP4 Products

Product Documents for DUSP4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DUSP4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DUSP4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DUSP4 Antibody - BSA Free and earn rewards!

Have you used DUSP4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...