dynein, cytoplasmic 2, light intermediate chain 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82946

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human dynein, cytoplasmic 2, light intermediate chain 1. Peptide sequence: EKLFPPKSINTLKDIKDPARDPQYAENEVDEMRIQKDLELEQYKRSSSKS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for dynein, cytoplasmic 2, light intermediate chain 1 Antibody - BSA Free

Western Blot: dynein, cytoplasmic 2, light intermediate chain 1 Antibody [NBP2-82946]

Western Blot: dynein, cytoplasmic 2, light intermediate chain 1 Antibody [NBP2-82946]

Western Blot: dynein, cytoplasmic 2, light intermediate chain 1 Antibody [NBP2-82946] - Host: Rabbit. Target Name: DYNC2LI1. Sample Type: Jurkat Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for dynein, cytoplasmic 2, light intermediate chain 1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: dynein, cytoplasmic 2, light intermediate chain 1

dynein, cytoplasmic 2, light intermediate chain 1 may function as a motor for intraflagellar retrograde transport. Functions in cilia biogenesis (By similarity)

Alternate Names

CGI-60, cytoplasmic dynein 2 light intermediate chain 1, D2LICDKFZp564A033, DKFZP564A033, dynein, cytoplasmic 2, light intermediate chain 1, LIC3Dynein 2 light intermediate chain

Gene Symbol

DYNC2LI1

Additional dynein, cytoplasmic 2, light intermediate chain 1 Products

Product Documents for dynein, cytoplasmic 2, light intermediate chain 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for dynein, cytoplasmic 2, light intermediate chain 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for dynein, cytoplasmic 2, light intermediate chain 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review dynein, cytoplasmic 2, light intermediate chain 1 Antibody - BSA Free and earn rewards!

Have you used dynein, cytoplasmic 2, light intermediate chain 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...