Dynein light chain 2 cytoplasmic Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54377

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding toDynein light chain 2 cytoplasmic(dynein, light chain, LC8-type 2) The peptide sequence was selected from the N terminal of Dynein light chain 2 cytoplasmic. Peptide sequence MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKY. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

10 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Dynein light chain 2 cytoplasmic Antibody - BSA Free

Western Blot: Dynein light chain 2 cytoplasmic Antibody [NBP1-54377]

Western Blot: Dynein light chain 2 cytoplasmic Antibody [NBP1-54377]

Western Blot: Dynein light chain 2 cytoplasmic Antibody [NBP1-54377] - Human Heart lysate, concentration 0.2-1 ug/ml.

Applications for Dynein light chain 2 cytoplasmic Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Dynein light chain 2 cytoplasmic

DYNLL2 belongs to the dynein light chain family. DYNLL2 may be involved in some aspects of dynein-related intracellular transport and motility. It may play a role in changing or maintaining the spatial distribution of cytoskeletal structures.

Alternate Names

Dlc2, DLC8b, DNCL1B, dynein light chain 2, cytoplasmic, Dynein light chain LC8-type 2,8 kDa dynein light chain b, dynein, light chain, LC8-type 2, MGC17810, radial spoke 22 homolog, RSPH22

Gene Symbol

DYNLL2

UniProt

Additional Dynein light chain 2 cytoplasmic Products

Product Documents for Dynein light chain 2 cytoplasmic Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Dynein light chain 2 cytoplasmic Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Dynein light chain 2 cytoplasmic Antibody - BSA Free

Customer Reviews for Dynein light chain 2 cytoplasmic Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Dynein light chain 2 cytoplasmic Antibody - BSA Free and earn rewards!

Have you used Dynein light chain 2 cytoplasmic Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...