Dynein light chain 2 cytoplasmic Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-92137

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-89 of human DYNLL2 (NP_542408.1). MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

10 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Dynein light chain 2 cytoplasmic Antibody - Azide and BSA Free

Western Blot: Dynein light chain 2 cytoplasmic AntibodyAzide and BSA Free [NBP2-92137]

Western Blot: Dynein light chain 2 cytoplasmic AntibodyAzide and BSA Free [NBP2-92137]

Western Blot: Dynein light chain 2 cytoplasmic Antibody [NBP2-92137] - Analysis of extracts of various cell lines, using Dynein light chain 2 cytoplasmic.Exposure time: 90s.

Applications for Dynein light chain 2 cytoplasmic Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Dynein light chain 2 cytoplasmic

Dynein may be involved in some aspects of dynein-related intracellular transport and motility. May play a role inchanging or maintaining the spatial distribution of cytoskeletalstructures

Alternate Names

Dlc2, DLC8b, DNCL1B, dynein light chain 2, cytoplasmic, Dynein light chain LC8-type 2,8 kDa dynein light chain b, dynein, light chain, LC8-type 2, MGC17810, radial spoke 22 homolog, RSPH22

Gene Symbol

DYNLL2

Additional Dynein light chain 2 cytoplasmic Products

Product Documents for Dynein light chain 2 cytoplasmic Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Dynein light chain 2 cytoplasmic Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for Dynein light chain 2 cytoplasmic Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Dynein light chain 2 cytoplasmic Antibody - Azide and BSA Free and earn rewards!

Have you used Dynein light chain 2 cytoplasmic Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...