Dynein light chain 2a cytoplasmic Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10681

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Dynein light chain 2a cytoplasmic Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human Dynein light chain 2a cytoplasmic (NP_054902). Peptide sequence EVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILK

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

11 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Dynein light chain 2a cytoplasmic Antibody - BSA Free

Western Blot: Dynein light chain 2a cytoplasmic Antibody [NBP3-10681]

Western Blot: Dynein light chain 2a cytoplasmic Antibody [NBP3-10681]

Western Blot: Dynein light chain 2a cytoplasmic Antibody [NBP3-10681] - Western blot analysis of Dynein light chain 2a cytoplasmic in Fetal Heart as a positive control. Antibody dilution at 1.0 ug/ml

Applications for Dynein light chain 2a cytoplasmic Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Dynein light chain 2a cytoplasmic

The Dynein light chain gene is a member of the roadblock dynein light chain family and encodes a cytoplasmic protein that is capable ofbinding intermediate chain proteins. Upregulation of this gene has been associated with hepatocellular carcinomas,suggesting that this gen

Alternate Names

BITH, Bithoraxoid-like protein, DNCL2Acytoplasmic dynein light chain 2A, DNLC2ABLP, Dynein light chain 2A, cytoplasmic, dynein light chain roadblock-type 1, dynein, cytoplasmic, light polypeptide 2A, dynein, light chain, roadblock-type 1, dynein-associated protein HKM23, Dynein-associated protein Km23, roadblock domain containing 1, Roadblock domain-containing protein 1, ROBL/LC7-like 1, ROBLD1Roadblock-1

Gene Symbol

DYNLRB1

Additional Dynein light chain 2a cytoplasmic Products

Product Documents for Dynein light chain 2a cytoplasmic Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Dynein light chain 2a cytoplasmic Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Dynein light chain 2a cytoplasmic Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Dynein light chain 2a cytoplasmic Antibody - BSA Free and earn rewards!

Have you used Dynein light chain 2a cytoplasmic Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies